KEGG   Mus musculus (mouse): 17999Help
Entry
17999             CDS       T01002                                 

Gene name
Nedd4, AA959633, AL023035, AU019897, E430025J12Rik, EG639396, Gm7265, KIAA0093, Nedd4-1, Nedd4a
Definition
(RefSeq) neural precursor cell expressed, developmentally down-regulated 4
  KO
K10591  E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04530  Tight junction
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    17999 (Nedd4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17999 (Nedd4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    17999 (Nedd4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    17999 (Nedd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17999 (Nedd4)
   04121 Ubiquitin system [BR:mmu04121]
    17999 (Nedd4)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17999 (Nedd4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     17999 (Nedd4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    17999 (Nedd4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   17999 (Nedd4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    17999 (Nedd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2 2OG-FeII_Oxy_4
Motif
Other DBs
NCBI-GeneID: 17999
NCBI-ProteinID: NP_035020
MGI: 97297
Ensembl: ENSMUSG00000032216
Vega: OTTMUSG00000044728
UniProt: P46935 B2RSC8
Structure
PDB: 

Position
9 D; 9 40.08 cM
AA seq 887 aa AA seqDB search
MSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGSPGSDVTDTCEPPCGCWELNPNSLEEE
HVLFTADPYLELHNDDTRVVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMSGILTSVQT
KTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENRLTRDDFLGQVDVPLYPLPTENPRME
RPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNGSEDENADQAEELEPGWVVLDQPDAAT
HLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPSPDDDLTDEDNDDMQLQAQR
AFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAVQSPPSGHIDVQTHLAEEFNT
RLAVCGNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLPVLLPTSSGLPPGWEEKQDDRGR
SYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTDSNDLGPLPPGWEERTHTDGRVFFIN
HNIKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQTDIPNKFEMKLRRANIL
EDSYRRIMGVKRADLLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSAT
DNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHD
MESVDSEYYSSLRWILENDPTELDLRFIIDEELFGQTHQHELKTGGSEIVVTNKNKKEYI
YLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTK
YKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVE
QWGTPDKLPRAHTCFNRLDLPPYESFDELWDKLQMAIENTQGFDGVD
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggacatggcagccgacgagtcggaggccccagtactctcggaggacgaggta
tgggagttttgcctggataagacagaagatggtggcggatcccccggaagtgatgttaca
gatacttgtgagcctccatgtggatgctgggagttgaatccgaattccctggaagaggag
cacgtgctgttcactgctgatccgtacctggagctccacaacgatgacacacgagttgtg
agagtgaaggttatagctggcataggcctggccaagaaagacatcttgggagccagtgat
ccttacgtaagagtgacattgtatgacccgatgagtggaatccttaccagcgtgcagaca
aaaactatcaaaaagtctttgaatccaaaatggaatgaagaaatactgttcagggtcctt
ccacagcgacaccgcattcttttcgaagtgtttgatgaaaatcgtttgacaagagatgat
ttcctaggtcaagtggatgtccctctctatcctttaccgactgaaaacccaagaatggag
agaccatatacatttaaggattttgttcttcatccaagaagtcacaaatcaagagttaaa
ggttatctgagattaaaaatgacttatttacctaaaaatggctcagaagatgaaaatgca
gaccaggctgaggagttagagcctggctgggttgttttggaccaaccagatgctgccact
catttgccgcatccaccagaaccctctcccctacctccaggatgggaagagaggcaggat
gtccttggaaggacctactacgtaaaccatgaatctagaagaacacagtggaaaaggcca
agccctgacgatgacctcacggatgaagacaatgatgatatgcagctgcaagcgcagcga
gcattcaccaccaggcggcagatatcggaggatgtggatggccctgacaaccgggagtcc
cctgagaattgggaaatcgtacgagaagatgaaaacaccgagtatagtggtcaggctgtc
cagtcacctccatcgggtcacattgatgtgcagactcaccttgcagaagagtttaatacc
agacttgctgtgtgtggaaatccagccaccagccagccggttaccagctcaaatcattcc
agcagaggaggcagcttgcagacctgtatctttgaggaacagcctacacttcctgtgctt
ttgcctacttcatctggattgccaccaggttgggaagaaaaacaagatgacagaggaaga
tcatactatgtagaccacaactctaaaaccaccacatggtccaagcccaccatgcaggat
gatccaagatcgaaaatccctgctcatctgagaggaaagactgactccaatgacctggga
cccttacctccaggctgggaagaaagaacccacacagatgggcgagtcttcttcataaac
cacaatataaagaagacccagtgggaagatcctcgcctgcagaacgtggcaatcactgga
ccagcagtgccctactccagagattacaagagaaagtacgagttcttcagaaggaagctc
aagaagcagactgacattccaaacaaatttgaaatgaagcttcgccgcgcaaacattctg
gaggattcttaccggaggattatgggtgtgaagagagctgacttgctcaaggccagactc
tggattgagtttgatggtgaaaagggccttgactatggaggggttgccagagagtggttc
ttcctcatctcgaaggaaatgttcaacccttactacggcctgtttgaatattctgctacg
gataattacaccctacagataaatcctaactcgggcttgtgtaatgaagatcacctctca
tacttcaagttcattggccgtgtggctgggatggcagtttatcatggcaagctgttggat
gggtttttcatccgtccgttttacaagatgatgcttcagaaactgataacactgcacgac
atggagtccgtggatagtgaatattacagttctctgcgatggattcttgaaaatgacccg
acggagctggacctgagatttatcatagatgaagaactttttggacagacacatcagcac
gaactgaaaaccggaggatcagagattgttgtcaccaataagaacaaaaaggagtatatc
taccttgtaatacaatggcgatttgtgaaccgtatccagaagcaaatggcagcttttaaa
gagggattttttgaactgataccacaggatctcatcaagatatttgatgaaaatgagcta
gagcttctcatgtgtggtctgggagatgtggatgtgaacgactggcgggaacacacaaaa
tacaaaaatggctacagcatgaaccaccaggtcatccactggttctggaaggctgtttgg
atgatggattcggaaaaaagaatacgcttacttcagtttgtcactggcacatcccgtgtg
ccgatgaatgggtttgctgaactctatggctcgaatggaccacaatccttcacagtggaa
caatggggcacccctgataagctgccaagagcacacacctgcttcaatcgcctggacctg
ccaccctacgaatcctttgacgaactctgggataaacttcagatggcaattgagaacaca
cagggctttgatggcgttgattag

DBGET integrated database retrieval system