KEGG   Mus musculus (house mouse): 18000
Entry
18000             CDS       T01002                                 
Symbol
Septin2, AW208991, Nedd-5, Nedd5, Sept2, mKIAA0158
Name
(RefSeq) septin 2
  KO
K16942  septin 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    18000 (Septin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18000 (Septin2)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    18000 (Septin2)
   04812 Cytoskeleton proteins [BR:mmu04812]
    18000 (Septin2)
   04147 Exosome [BR:mmu04147]
    18000 (Septin2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    18000 (Septin2)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   18000 (Septin2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     18000 (Septin2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   18000 (Septin2)
SSDB
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU RsgA_GTPase AIG1 Ras Dynamin_N AAA_22 AAA_16 Roc VirE ABC_tran AAA_29 AAA_7
Other DBs
NCBI-GeneID: 18000
NCBI-ProteinID: NP_001153189
MGI: 97298
Ensembl: ENSMUSG00000026276 ENSMUSG00000116048
UniProt: P42208
Structure
Position
1:93406671..93437455
AA seq 361 aa
MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLT
DLYPERIIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIIS
YIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV
IAKADTLTLKERERLKKRILDEIEEHSIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVV
GSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFR
SERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDSDSGALGQH
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctaagcaacaaccaactcagtttataaatccagaaactcctggctatgttggattt
gcaaatcttcccaatcaagttcaccgaaaatcagtgaagaaggggttcgagttcactctg
atggtggttggtgaatctggtctaggaaaatcaactctcataaacagcttattcctgact
gatctctacccagaaagaattattcctggagctgcagagaaaattgaaagaactgtccag
atagaggcttcgactgttgagattgaagagcggggtgtgaagctgcggcttacagtagtg
gacactcccggctacggggatgccatcaactgcagggattgtttcaagacaattatctcc
tacattgatgagcagtttgaacgctacctacatgatgagagtggactgaacaggcgtcac
atcattgataacagggtacattgttgcttctacttcatttcaccttttggacatggactg
aagcccttagatgttgcatttatgaaagcgatacacaataaggtgaatattgtgcctgtc
attgcgaaagctgacactctcactctgaaggagcgtgagcggcttaagaaaaggattttg
gatgaaattgaagagcatagcattaaaatctatcacttacctgatgcagagtcagatgaa
gatgaagactttaaggagcagactagactcctcaaggccagtatcccattctctgtggtt
ggctccaaccagttgattgaagccaaaggcaagaaggttagaggccgtctctacccatgg
ggtgttgtagaggtggagaacccagaacacaatgactttctgaagctgagaacgatgctc
atcacccacatgcaggacctacaggaagtgacccaagaccttcactatgaaaacttccgt
tctgagaggctgaagagaggcggcaggaaagtagagaatgaggacatgaataaagaccag
atcttgcttgaaaaggaggctgagctccgccgcatgcaagagatgattgcaagaatgcaa
gcgcagatgcagatgcagatgcagggtggtgacagtgacagcggggctctcgggcagcat
gtgtga

DBGET integrated database retrieval system