KEGG   Mus musculus (mouse): 18004
Entry
18004             CDS       T01002                                 

Gene name
Nek1, D8Ertd790e, kat
Definition
(RefSeq) NIMA (never in mitosis gene a)-related expressed kinase 1
  KO
K08857  NIMA (never in mitosis gene a)-related kinase 1/4/5 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18004 (Nek1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    18004 (Nek1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18004 (Nek1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18004 (Nek1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NEK family
   18004 (Nek1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    18004 (Nek1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    18004 (Nek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 18004
NCBI-ProteinID: NP_780298
MGI: 97303
Ensembl: ENSMUSG00000031644
Vega: OTTMUSG00000031430
UniProt: P51954 Q3UXI0
Position
8 B3.1; 8 30.91 cM
AA seq 1203 aa
MEKYVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKH
PNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVH
DRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPY
NNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFK
RNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTLSKFGPQPLPGKRPASGQGVS
SFVPAQKITKPAAKYGVPLTYKKYGDKKLLEKKPPPKHKQAHQIPVKKMNSGEERKKMSE
EAAKKRRLEFIEKEKKQKDQIRFLKAEQMKRQEKQRLERINRAREQGWRNVLRAGGSGEV
KASFFGIGGAVSPSPCSPRGQYEHYHAIFDQMQRLRAEDNEARWKGGIYGRWLPERQKGH
LAVERANQVEEFLQRKREAMQNKARAEGHVVYLARLRQIRLQNFNERQQIKAKLRGENKE
ADGTKGQEATEETDMRLKKMESLKAQTNARAAVLKEQLERKRKEAYEREKKVWEEHLVAR
VKSSDVPLPLELLETGGSPSKQQVKPVISVTSALKEVGLDGSLTDTQEEEMEKSNSAISS
KREILRRLNENLKAQEDEKEKQHHSGSCETVGHKDEREYETENAISSDRKKWEMGGQLVI
PLDAVTLDTSFSATEKHTVGEVIKLDSNGSPRKVWGKNPTDSVLKILGEAELQLQTELLE
NTSFKSEVYAEEENYKPLLTEEENLQCISKEINPSATVDSTETKSPKFTEVSPQMSEGNV
EEPDDLETEVLQEPSSTHTDGSLPPVLNDVWTREKEAAKETELEDKVAVQQSEVCEDRIP
GNVDQSCKDQRDPAVDDSPQSGCDVEKSVQPESIFQKVVHSKDLNLVQAVHCSPEEPIPI
RSHSDSPPKTKSKNSLLIGLSTGLFDANNPKMLRTCSLPDLSKLFRTLMDVPTVGDVHQD
SLEIDELEDEPIKEGPSDSEDTVFEETDTDLQELQASMEQLLREQPGDEYSEEEESVLKS
SDVEQTARGTDAPDEEDNPSSESALNEEWHSDNSDAETTSECEYDSVFNHLEELRLHLEQ
EMGFEKFFEVYEKVKAIHEDEDENIEICSTIVENILGNEHQHLYAKILHLVMADGAYQED
NDE
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggagaagtatgtgagactgcagaagattggagaaggttcatttggaaaagctgttctt
gttaaatcgacagaggatggcagacattatgtcatcaaggaaattaacatctcaagaatg
tctgataaagaaaggcaagaatcaaggagagaagttgctgtattggcaaacatgaagcat
ccaaatattgtccaatataaagaatcatttgaagaaaatggctctctctacatagtaatg
gattactgtgaaggaggtgatttgtttaaacgaataaatgctcagaaaggcgctctgttt
caagaagaccagattttggactggtttgtgcagatatgtttggctctgaagcatgtacat
gatagaaaaattcttcaccgagacataaagtcacagaacatatttctaaccaaagatggg
acagtgcagcttggagattttggaattgctcgagttcttaatagtactgtagagctggct
cgaacttgcataggcactccatactacttgtcacctgaaatctgtgaaaacaagccttat
aacaataaaagtgacatttgggctttgggctgtgtcctttatgagttgtgtacacttaaa
catgcatttgaagctggaaacatgaaaaacctggtactgaagataatctccggatccttt
cctccagtgtctccacattactcctatgatctccgcagcttgctgtctcagttatttaaa
agaaatcctagggatagaccatcagtcaactccatattggagaaaggttttatagctaaa
cgaatcgaaaagtttctctcccctcagcttattgcagaagaattttgtctaaaaacactt
tcaaagtttggaccacagcctctcccaggtaaaagaccagcatcaggacaaggtgtcagt
tcttttgtccctgctcagaaaatcacaaagcctgctgctaaatacggagtgcctttaaca
tataagaagtatggagataaaaagttacttgagaaaaaaccacccccaaaacataaacag
gcccatcaaattcccgtgaagaaaatgaattctggagaagaaaggaagaaaatgtctgag
gaagcagcaaaaaaaagaaggttggaatttattgagaaagaaaagaagcaaaaggatcag
attaggttcctgaaggctgagcagatgaagcggcaagagaagcagcggttggagaggata
aatagggccagggaacaaggatggaggaatgttttaagggctggtggaagcggtgaagta
aaggcttccttttttggcattggaggggctgtctctccatcaccgtgttctcctcgaggc
cagtatgaacattaccatgccatttttgaccaaatgcagcggctaagagcagaagataat
gaagcaagatggaaggggggaatctatggtcgatggctcccagaaaggcaaaaaggacac
ttagctgtagagagagccaaccaagtggaagaattcctacagcgtaaacgagaagctatg
cagaataaagcccgagccgaaggacacgtggtttatttggcaagactgaggcaaataaga
ctacaaaattttaatgagcgccaacagattaaagccaaacttcgtggtgagaataaagaa
gctgatggtaccaaaggacaagaagcaactgaagagactgacatgaggctcaaaaagatg
gagtcacttaaggcgcaaacaaatgcacgtgctgctgtactaaaagaacagctggagcga
aaaagaaaggaagcttatgaaagagaaaagaaagtatgggaagaacatttggtggcgagg
gtaaaaagctcagatgttcctctgcctttggaacttcttgaaacaggtggttctccatca
aagcagcaggtgaagcctgtcatttctgtgacttcagctttgaaagaagtgggcctggat
ggaagtttaactgatacccaggaagaagaaatggaaaagagtaacagtgctatttcaagt
aagcgagaaatcctgcgtaggctaaatgaaaatcttaaagctcaagaggatgaaaaggaa
aagcagcatcactcaggttcttgtgagaccgttggtcacaaagatgagagagagtatgag
acagaaaatgccatttcctctgatcgcaagaagtgggagatgggaggtcagcttgtgatt
cctctcgatgcagtgacactggatacatccttctctgcaaccgaaaaacatactgtggga
gaggttattaaattagattctaatggctctccaagaaaagtctgggggaaaaaccctaca
gattctgtgctgaagatacttggagaagctgaattacagctacagacagaactactagaa
aacacatcttttaaaagtgaggtttatgctgaagaggagaactacaaacccttacttact
gaagaagagaatctgcagtgcatttcaaaagaaataaatccatcagctactgttgattct
actgaaacgaaaagtccaaagtttactgaggtgtctccacaaatgtcagaaggaaatgtg
gaagaacctgatgatttggaaacagaagttctacaagagccaagtagcacacacacagat
gggagtttgccacctgttcttaatgatgtgtggactagagagaaggaagcagctaaggaa
actgagttggaagataaggttgctgtgcagcagagtgaagtttgtgaagatagaattcca
gggaacgtggaccaatcctgtaaggatcagagagatcctgcagtagacgattctccgcag
tctggctgtgatgtagagaagtcagtacagccagaatcgattttccagaaagtggttcat
tctaaggacttgaacttagttcaggcagttcattgctcaccagaagaaccaattccaatt
cgatctcactctgattctccaccaaaaactaagagcaagaattccttactgattggactt
tcaactggtctgtttgatgcaaacaatccaaagatgctgaggacctgctcacttccagat
ctttccaagctgttcagaaccctaatggacgttcccactgtgggggacgttcatcaagac
agtcttgaaatcgatgagctggaagatgaaccaattaaagaagggccttctgattccgaa
gacactgtatttgaagaaactgacacagatttacaagagcttcaggcctcaatggagcag
ctgcttagggagcaaccaggtgacgaatacagtgaggaggaagagtctgttttaaaaagc
agcgatgtggagcagacagcaagagggacagatgccccagacgaggaggacaaccccagc
agcgaaagcgccctgaacgaggaatggcactcagataatagtgacgctgagaccactagt
gaatgtgaatatgacagtgtctttaaccatttagaggaactaagacttcacttggagcaa
gaaatgggctttgaaaagttctttgaggtttatgagaaagtaaaggctattcatgaggat
gaagatgaaaatattgaaatttgttcaacaatagttgagaatattttgggcaatgagcac
cagcatctctatgccaagattctgcatttagtcatggcagatggagcctatcaggaagat
aatgatgaataa

DBGET integrated database retrieval system