KEGG   Mus musculus (mouse): 18012
Entry
18012             CDS       T01002                                 

Gene name
Neurod1, BETA2, BHF-1, Nd, Nd1, Neu, Neurod, bHLH, bHLHa3
Definition
(RefSeq) neurogenic differentiation 1
  KO
K08033  neurogenic differentiation factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    18012 (Neurod1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18012 (Neurod1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    18012 (Neurod1)
SSDB
Motif
Pfam: Neuro_bHLH HLH CCDC106 YL1 Nop14 CDC45 Nop53 Drc1-Sld2
Other DBs
NCBI-GeneID: 18012
NCBI-ProteinID: NP_035024
MGI: 1339708
Ensembl: ENSMUSG00000034701
Vega: OTTMUSG00000013310
UniProt: Q60867
Structure
PDB: 
2QL2

Position
2 C3; 2 47.58 cM
AA seq 357 aa
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDELEAMNAEEDSLRNGGEEE
EEDEDLEEEEEEEEEEEDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNPDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGPQSHGSIFSSGAAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaccaaatcatacagcgagagcgggctgatgggcgagcctcagccccaaggtccccca
agctggacagatgagtgtctcagttctcaggacgaggaacacgaggcagacaagaaagag
gacgagcttgaagccatgaatgcagaggaggactctctgagaaacgggggagaggaggag
gaggaagatgaggatctagaggaagaggaggaagaagaagaggaggaggaggatcaaaag
cccaagagacggggtcccaaaaagaaaaagatgaccaaggcgcgcctagaacgttttaaa
ttaaggcgcatgaaggccaacgcccgcgagcggaaccgcatgcacgggctgaacgcggcg
ctggacaacctgcgcaaggtggtaccttgctactccaagacccagaaactgtctaaaata
gagacactgcgcttggccaagaactacatctgggctctgtcagagatcctgcgctcaggc
aaaagccctgatctggtctccttcgtacagacgctctgcaaaggtttgtcccagcccact
accaatttggtcgccggctgcctgcagctcaaccctcggactttcttgcctgagcagaac
ccggacatgcccccgcatctgccaaccgccagcgcttccttcccggtgcatccctactcc
taccagtcccctggactgcccagcccgccctacggcaccatggacagctcccacgtcttc
cacgtcaagccgccgccacacgcctacagcgcagctctggagcccttctttgaaagcccc
ctaactgactgcaccagcccttcctttgacggacccctcagcccgccgctcagcatcaat
ggcaacttctctttcaaacacgaaccatccgccgagtttgaaaaaaattatgcctttacc
atgcactaccctgcagcgacgctggcagggccccaaagccacggatcaatcttctcttcc
ggtgccgctgcccctcgctgcgagatccccatagacaacattatgtctttcgatagccat
tcgcatcatgagcgagtcatgagtgcccagcttaatgccatctttcacgattag

DBGET integrated database retrieval system