KEGG   Mus musculus (mouse): 18018
Entry
18018             CDS       T01002                                 

Gene name
Nfatc1, 2210017P03Rik, AI449492, AV076380, NF-A, NF-ATc, NFA, NFAT2, NFATc, Nfatcb
Definition
(RefSeq) nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05135  Yersinia infection
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18018 (Nfatc1)
   04310 Wnt signaling pathway
    18018 (Nfatc1)
   04024 cAMP signaling pathway
    18018 (Nfatc1)
   04022 cGMP-PKG signaling pathway
    18018 (Nfatc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    18018 (Nfatc1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    18018 (Nfatc1)
   04650 Natural killer cell mediated cytotoxicity
    18018 (Nfatc1)
   04660 T cell receptor signaling pathway
    18018 (Nfatc1)
   04658 Th1 and Th2 cell differentiation
    18018 (Nfatc1)
   04659 Th17 cell differentiation
    18018 (Nfatc1)
   04662 B cell receptor signaling pathway
    18018 (Nfatc1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    18018 (Nfatc1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18018 (Nfatc1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18018 (Nfatc1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18018 (Nfatc1)
   05170 Human immunodeficiency virus 1 infection
    18018 (Nfatc1)
   05161 Hepatitis B
    18018 (Nfatc1)
   05163 Human cytomegalovirus infection
    18018 (Nfatc1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18018 (Nfatc1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18018 (Nfatc1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    18018 (Nfatc1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    18018 (Nfatc1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18018 (Nfatc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18018 (Nfatc1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    18018 (Nfatc1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 18018
NCBI-ProteinID: NP_001157581
MGI: 102469
Ensembl: ENSMUSG00000033016
UniProt: B5B2N5
Position
18 E3; 18 53.66 cM
AA seq 717 aa
MPSTSFPVPSKFPLGPPAAVCGSGETLRPAPPSGGTMKAAEEEHYSYVSPSVTSTLPLPT
AHSALPAACHDLQTSTPGISAVPSANHPPSYGGAVDSGPSGYFLSSGNTRPNGAPTLESP
RIEITSYLGLHHGSGQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLS
SRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSP
STSPRASITEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTED
TWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLG
TTPPTSDFPPEEYTFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQL
PSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIG
TADDRLLRPHAFYQVHRITGKTVSTTSHEIILSNTKVLEIPLLPENNMRAIIDCAGILKL
RNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVE
KQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVE
IPPFRNQRITSPVQVSFYVCNGKRKRSQYQRFTYLPANGNSVFLTLSSESELRGGFY
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgccaagtaccagctttccagtcccttccaagtttccactcggccctccggccgcagtc
tgcgggagcggagaaactttgcggcccgcgccgccctccggcggcaccatgaaggcggcc
gaggaagaacactacagttatgtgtcccctagtgtcacctcgaccctgccccttcccaca
gcacactctgccttgccagcagcatgccacgacctccagacgtccaccccgggtatctca
gctgttccttcagccaatcatccccccagttacggaggggctgtggacagcgggccttcg
ggatacttcctgtcctctggcaacaccagacccaacggggccccgactctggagagtccg
agaatcgagatcacctcctacctgggcctacaccatggcagcggccagtttttccacgac
gtggaggtggaagacgtacttcctagctgcaagcgctcaccgtctacagcaaccctgcac
ctgcccagcctggaagcctacagagacccctcctgcctgagcccagccagcagtctctcc
tccagaagctgtaactctgaggcctcctcctacgagtccaactactcctacccatacgcg
tccccccagacctctccgtggcagtcaccctgcgtgtctcccaagaccacggacccggag
gagggttttccccgaagcctgggtgcctgccacctgctaggatcgcccaggcactcccca
tccacctctcctcgggcaagcatcacggaggagagctggctcggtgcccgcggctcccgg
cccacgtccccctgcaacaagcgcaagtacagtctcaatggccggcagccctcctgctca
ccccaccactcacccacaccatccccccatggctcccctcgggtcagtgtgaccgaagat
acctggctcggtaacaccacccagtataccagctctgccattgtggcagccatcaacgcc
ctgaccaccgatagcactctggacctgggtgatggggtccctatcaagtctcgaaagaca
gcactggagcatgcgccctctgtggccctcaaagtagagccagctggggaagacctgggc
accactccacccacttctgacttcccacccgaggagtacaccttccagcaccttcggaag
ggtgccttttgcgagcagtatctgtcggtgccacaggcctcgtatcagtgggcgaagccc
aagtctctttccccgacatcatatatgagcccatccttgcctgcccttgactggcagctc
ccgtcacattctggtccatacgagcttcggatcgaggtgcagcccaagtctcaccacagg
gctcactatgagacggaaggcagccggggggctgtgaaggcttcagctggaggacacccc
attgtgcagctacacggttacttggagaatgaacctctcacgctacagctgttcattggg
acggctgacgaccgcctgctgaggccccacgccttctaccaggtccaccggatcacgggg
aagactgtctccaccaccagccacgagatcatcctgtccaacaccaaagtcctggagatc
ccgttgcttccagaaaataacatgcgagccatcatcgactgtgctgggatcctgaagctc
agaaactctgatattgagctgaggaaaggggagacagacatcgggaggaagaacaccagg
gtgaggctggtcttccgagttcacatcccacagcccaatggccggacgctgtctctccag
gtggcctcgaaccctatcgagtgttcccagcggtcagcccaggagctgcccctcgtggag
aagcagagcacagacagctacccagtcatcggcgggaagaagatggtgctgtctggccat
aactttctgcaagactccaaagtcattttcgtggagaaggctccagatggccaccacgtc
tgggagatggaagcaaagactgaccgggacctgtgcaagccaaattccctggtggttgag
ataccacctttccgcaaccagaggataaccagccccgtccaagtcagtttctatgtctgc
aacgggaaacggaagagaagccagtaccagcgtttcacgtaccttcctgccaatggtaac
tctgtctttctaaccttaagctctgagagtgagctgagaggaggtttttactga

KEGG   Mus musculus (mouse): 18019
Entry
18019             CDS       T01002                                 

Gene name
Nfatc2, AI607462, NF, NF-ATc2, NF-ATp, NFA, NFAT1, NFAT1-D, Nfatp
Definition
(RefSeq) nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05135  Yersinia infection
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    18019 (Nfatc2)
   04370 VEGF signaling pathway
    18019 (Nfatc2)
   04022 cGMP-PKG signaling pathway
    18019 (Nfatc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    18019 (Nfatc2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    18019 (Nfatc2)
   04650 Natural killer cell mediated cytotoxicity
    18019 (Nfatc2)
   04660 T cell receptor signaling pathway
    18019 (Nfatc2)
   04658 Th1 and Th2 cell differentiation
    18019 (Nfatc2)
   04659 Th17 cell differentiation
    18019 (Nfatc2)
   04662 B cell receptor signaling pathway
    18019 (Nfatc2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    18019 (Nfatc2)
  09158 Development and regeneration
   04360 Axon guidance
    18019 (Nfatc2)
   04380 Osteoclast differentiation
    18019 (Nfatc2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18019 (Nfatc2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18019 (Nfatc2)
   05170 Human immunodeficiency virus 1 infection
    18019 (Nfatc2)
   05161 Hepatitis B
    18019 (Nfatc2)
   05163 Human cytomegalovirus infection
    18019 (Nfatc2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18019 (Nfatc2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18019 (Nfatc2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    18019 (Nfatc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18019 (Nfatc2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    18019 (Nfatc2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 18019
NCBI-ProteinID: NP_035029
MGI: 102463
Ensembl: ENSMUSG00000027544
Vega: OTTMUSG00000016052
UniProt: Q60591 B5B2P6
Position
2 H3; 2 88.91 cM
AA seq 927 aa
MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHKAISSPSGLAY
PDDVLDYGLKPCNPLASLSGEPPGRFGEPDSIGFQNFLSPVKPAGASGPSPRIEITPSHE
LMQAGGALRGRDAGLSPEQPALALAGVAASPRFTLPVPGYEGYREPLCLSPASSGSSASF
ISDTFSPYTSPCVSPNNAGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPV
PRPASRSSSPGAKRRHSCAEALVAPLPAASPQRSRSPSPQPSPHVALQDDSIPAGYPPTA
GSAVLMDALNTLATDSPCGIPSKIWKTSPDPTPVSTAPSKAGLARHIYPTVEFLGPCEQE
ERRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSNQSGSYELRIEVQPKP
HHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
ITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRK
NTRVRLVFRVHVPEPSGRIVSLQAASNPIECSQRSAHELPMVERQDMDSCLVYGGQQMIL
TGQNFTAESKVVFMEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRVPVKVNF
YVINGKRKRSQPQHFTYHPVPAIKTEPSDEYEPSLICSPAHGGLGSQPYYPQHPMLAESP
SCLVATMAPCQQFRSGLSSPDARYQQQSPAAALYQRSKSLSPGLLGYQQPSLLAAPLGLA
DAHRSVLVHAGSQGQGQGSTLPHTSSASQQASPVIHYSPTNQQLRGGGHQEFQHIMYCEN
FGPSSARPGPPPINQGQRLSPGAYPTVIQQQTAPSQRAAKNGPSDQKEALPTGVTVKQEQ
NLDQTYLDDVNEIIRKEFSGPPSRNQT
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggacgtcccggagccgcagcccgaccccgatggcggggacggccccggccacgagccc
gggggcagtccccaagacgagctggacttttccatcctcttcgattatgactatctgaac
cctatcgaagaagaaccgatcgcacataaggccatcagctcaccctccggactcgcatac
ccggatgatgtcctggactatggcctcaagccatgcaacccccttgccagtctctctggc
gagccccctggccggttcggagagccggatagtatagggttccagaactttctgagcccg
gtcaagccagcaggggcttcgggcccgagccctcggatcgagatcactccatcccacgaa
ctgatgcaggcagggggggccctccgtgggagagacgccggcctgtcccccgagcagccg
gccctggccctggccggcgtggccgccagcccgaggttcacactgcccgtgcccggctac
gagggctaccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttc
atttctgacaccttctccccctacacctcgccctgcgtctcacccaataacgccgggccc
gacgacctgtgtccccagtttcaaaacatccctgctcattattcccccagaacctctcca
ataatgtcacctcgaaccagcctcgccgaggacagctgcctgggccgacactcgcccgtg
ccccgtccggcatcccgctcctcctcacccggtgccaagcggaggcattcgtgcgcagag
gctttggttgctcctctgcccgcagcctcaccccagcgctcccggagcccctcgccacag
ccctcgcctcacgtggcactgcaggacgacagcatccccgctgggtacccccccacggcc
ggctctgctgttctcatggatgccctcaacaccctggccaccgactcgccctgcgggatc
ccctccaagatatggaagaccagtcctgacccgacgcctgtgtccaccgctccgtccaag
gctggcctggcccgccacatctaccctactgtggagttcctggggccatgtgagcaggag
gagaggaggaattccgctccagagtccatcctgctggtaccacctacttggcccaagcag
ttggtgccggccattcccatctgcagcatccctgtgactgcatccctcccaccactcgag
tggccactctccaatcagtcgggctcctatgagctacggattgaggtccaacccaagccc
catcaccgggcccactatgagacggagggcagccgtggcgctgtcaaagccccaacagga
ggacaccctgtggtgcagctccacggctacatggagaacaagcctctggggcttcagatc
ttcattgggacagcagatgagaggatccttaagccgcacgccttctaccaagtacacagg
atcactgggaaaacggtcaccaccacgagctatgagaagatcgtaggcaacaccaaggtc
ctggagatccccctggagccaaagaacaacatgagagccaccatcgactgtgcaggcatc
ctgaagctccgaaacgctgacatcgagctgcggaagggcgagacggacatcggcaggaag
aacacgcgtgtgcgcctggtgttccgcgtgcacgtcccagagcccagtgggcgcatcgtc
tccctgcaggctgcgtccaaccccatcgagtgctctcagcgctctgcccacgagctgccc
atggtggagagacaagacatggacagctgcctggtctacgggggccagcagatgatcctc
acgggccagaacttcacagcggagtccaaggttgtgttcatggagaagactacagatggg
cagcagatttgggagatggaagctacggtggataaagacaagagccagcctaacatgctt
tttgttgagatccccgagtatcggaacaagcacatccgcgtgcccgtgaaagtcaacttc
tacgtcatcaacggaaagaggaaacgaagtcagccacagcactttacctaccacccagtc
cctgccatcaagacagagcccagcgatgagtatgaaccatctttgatctgcagccccgcc
catggaggcctggggagccagccatattacccacagcacccaatgctggccgagtccccc
tcctgccttgtggctaccatggccccctgccaacagttccgctcggggctctcatccccc
gatgctcgctaccaacagcagagccccgcagctgccctctaccagagaagcaagagcctg
agtcccggcctgctgggctaccagcagccgtccctcctggcagcacccttgggtctggct
gatgcccaccgctctgtgctggtgcatgctggttctcaggggcaggggcagggctccacc
ctgccacacacatcctcggccagccagcaggcctcacccgtgatccactactcacccacc
aaccagcagcttcgcggtgggggtcaccaggagttccagcatatcatgtactgtgaaaac
ttcggccccagctctgccaggcctggcccgcctcccatcaaccaaggtcagaggctgagc
ccgggcgcctaccccacagtcatccaacaacagactgccccgagccaaagagctgccaaa
aacggacccagtgaccagaaggaagctctgcccacgggagtgaccgtcaaacaggaacag
aacctggaccagacctacctggatgacgttaatgaaatcatcaggaaggagttttcagga
cctccctcccgaaatcagacctag

KEGG   Mus musculus (mouse): 18021
Entry
18021             CDS       T01002                                 

Gene name
Nfatc3, C80703, D8Ertd281, D8Ertd281e, NFA, NFAT4, NFATx
Definition
(RefSeq) nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04625  C-type lectin receptor signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05135  Yersinia infection
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18021 (Nfatc3)
   04310 Wnt signaling pathway
    18021 (Nfatc3)
   04022 cGMP-PKG signaling pathway
    18021 (Nfatc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    18021 (Nfatc3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    18021 (Nfatc3)
   04660 T cell receptor signaling pathway
    18021 (Nfatc3)
   04658 Th1 and Th2 cell differentiation
    18021 (Nfatc3)
   04659 Th17 cell differentiation
    18021 (Nfatc3)
   04662 B cell receptor signaling pathway
    18021 (Nfatc3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    18021 (Nfatc3)
  09158 Development and regeneration
   04360 Axon guidance
    18021 (Nfatc3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18021 (Nfatc3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18021 (Nfatc3)
   05170 Human immunodeficiency virus 1 infection
    18021 (Nfatc3)
   05161 Hepatitis B
    18021 (Nfatc3)
   05163 Human cytomegalovirus infection
    18021 (Nfatc3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18021 (Nfatc3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18021 (Nfatc3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    18021 (Nfatc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18021 (Nfatc3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    18021 (Nfatc3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 18021
NCBI-ProteinID: NP_001355725
MGI: 103296
Ensembl: ENSMUSG00000031902
Vega: OTTMUSG00000061942
Position
8 D3; 8 53.08 cM
AA seq 1068 aa
MTTANCGAHDELDFKLVFGEDGAPAPVSQVSRPADLEPDDCASIYIFNVDPPPSTLNSSL
GLPHHGLLQSHSSVLSPSFQLQGYKNYEGTGDISESKYSPLGGPKPFECPSIQITSISPN
CHQGTDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDA
SSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGSGHSLSPRQ
SPCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGH
SPRGSVTEDTWLTAPVHTGSGLSPAPFPFQYCVETDIPLKTRKTSEDQAAILPGKLEICS
DDQGNLSPSRETSVDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEAEGKIIREKCQGAH
IVLEVPPYHNPAVTSAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEQREDTDLPSVPSLP
VPHSAQAQRPSSETGHPHDRAMSAPGSLLCQVQPAYTSMVASTHLPQLQCRDEGAGKEQH
IATSSVMHQPFQVTPTSPIGSSYQSIQTSMYNGPTCLPVNPASSQEFDPVLFQQDAALSS
LVNLGCQPLSPIPFHSSNSDATGHLLAHSPHSVQTPPHLQSMGYHCSNAGQTALSSPVAD
QITGQPSSHLQPITYCPSHPGSATAASPAASHPLASSPISGPSSPQLQPMPYQSPSSGTA
SSPSPTTRMHSGQHSTQAQSTGQGGLSVPSSLVCHSLCDPASFPPGGATVSIKPEPEDQE
PNFATIGLQDITLDDDQFISDLEHQPSGSTEKWPNHSEFSCPVPFWRI
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtcttcggcgag
gacggggcaccagcgccggtgtcccaggtctcgcggcctgcagatcttgaaccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcatccctt
ggcttaccacatcatggactgctgcagtctcactcttctgttttgtcaccatcatttcag
ctccaaggttacaaaaattatgaaggaactggtgatatttctgaatctaaatatagtcca
ttaggtggtcctaaaccctttgagtgcccaagtattcaaatcacatccatttctcctaac
tgtcatcaaggaacagatgctcatgaagatgacctacatataaatgacccagaaagggaa
tatttggaaaggccttctagagatcatctctatcttccacttgagccatcctaccgggaa
tcttccctcagtcctagtcctgccagcagcatttcttctaggagctggttctcagatgca
tcttcttgtgaatctctctcccacatttatgatgatgtggactcagagttgaatgaagct
gctgcacgattcactcttggttcacctctgacttctccaggtggctctccaggaggttgc
cctggagaagagtcctggcatcaacagtatggatctggacactccttgtcacctaggcaa
tctccttgccactctcctagatctagtatcactgatgagaattggctgagccccagacca
gcctcaggaccctcatcaaggcccacttctccctgtggtaaacgacggcactccagtgct
gaagtatgttatgctggttccctttcaccccatcactcgcctgttccatcccctggtcac
tctcctagaggaagtgtaacagaagatacctggctcactgctcctgtccacactggatca
ggcctcagccctgcaccgtttccatttcagtactgtgtagagactgacatccctttgaaa
acaaggaagacttctgaagatcaagctgccatactaccaggaaaattagagatctgttca
gatgatcaagggaacttatccccttcccgggagacatcagtagatgatggccttggatct
cagtatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcacccttt
acctggagcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctcca
ttagactggcctttaccaactcactttggacaatgtgaattgaaaatagaagtgcaacct
aaaactcaccatagagcccattatgaaactgaaggtagccgaggggcagtgaaagcctct
actggtggccatcctgttgtgaagctcctgggctatagtgaaaagccaataaatctacag
atgtttattggaacagccgatgatagatatttacgacctcatgcattttaccaggtgcat
cggattactggaaagacagttgctactgcaagtcaagagataataatcgccagcacaaaa
gttctggaaatcccacttctacctgaaaataatatgtcagcgagtattgactgtgcaggt
attttaaagctccgcaactcagatatagaacttcgaaaaggagaaactgatattggcaga
aaaaatactagagtccgacttgtatttcgtgtgcacatcccacagcccagtggaaaagtt
ctttctctacagatagcatctattcctgttgagtgctctcagcgatctgctcaagaactc
cctcatattgagaagtacagtatcaacagttgctctgtcaatggaggccacgaaatgatt
gtgactggatctaattttcttccagaatccaaaataatttttcttgaaaaaggacaagat
ggaagacctcattgggaggctgaaggaaaaataatcagagaaaaatgtcaaggggctcac
attgtccttgaagttcctccctatcataacccagcagttacatctgccgtgcaggtgcac
ttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacacca
gttttgatgaagcaagaacaaagagaagacacagatttgccttcagttccatctttgcct
gtgcctcattctgcccaggcccagaggccctcctcagagacagggcacccccatgaccgt
gcgatgtcagcaccgggaagcctgctttgtcaagtgcagccagcatatacatctatggta
gcctccacccatttgccacagttgcagtgtagggatgaaggtgctggtaaagagcagcac
atagcaacatcttcagtcatgcaccagcctttccaagttacaccaacatctcctataggg
tcttcctatcagtctatacaaactagtatgtataacggtccaacctgtcttcctgtgaat
cctgcctctagtcaagaatttgacccagttttgtttcagcaagatgcagctctttctagt
ttagtaaatcttggctgtcaaccactgtcaccaataccatttcattcttcaaattcagat
gcgacaggacatctcttagcacattcacctcattctgtgcaaaccccacctcatctgcag
tcaatgggataccattgttcaaatgcaggacaaacagctctttcttctccagtggcagac
cagatcacaggtcagccttcttctcatttacagcctattacatattgtccttcacaccca
ggatctgctacagcagcttccccagcagcctctcatcctctggctagttcaccgatttct
gggccatcatcccctcagctgcagcctatgccttatcaatctcctagctcaggaactgcc
tcatcaccatctccaactaccagaatgcattctggacagcactcaactcaagcacaaagt
acaggccaaggaggcctttctgttccttcatccttagtatgtcacagtttgtgtgaccca
gcgtcatttccgcctggtggtgcaactgtgagcattaaacctgaacctgaagatcaagaa
cctaactttgcaaccattggtctacaggatatcaccttagatgatgaccagtttatatct
gacttggaacaccagccatcaggttcaacagagaaatggcccaatcacagtgagttctca
tgtccagttcctttctggagaatctag

DBGET integrated database retrieval system