KEGG   Mus musculus (mouse): 18024
Entry
18024             CDS       T01002                                 

Gene name
Nfe2l2, Nr, Nrf2
Definition
(RefSeq) nuclear factor, erythroid derived 2, like 2
  KO
K05638  nuclear factor erythroid 2-related factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05012  Parkinson disease
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18024 (Nfe2l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18024 (Nfe2l2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    18024 (Nfe2l2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    18024 (Nfe2l2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18024 (Nfe2l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18024 (Nfe2l2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    18024 (Nfe2l2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    18024 (Nfe2l2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    18024 (Nfe2l2)
SSDB
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 18024
NCBI-ProteinID: NP_035032
MGI: 108420
Ensembl: ENSMUSG00000015839
Vega: OTTMUSG00000013248
UniProt: Q60795
Structure
PDB: 
3WN7

Position
2 C3; 2 44.75 cM
AA seq 597 aa
MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQE
QLQKEQEKAFFAQFQLDEETGEFLPIQPAQHIQTDTSGSASYSQVAHIPKQDALYFEDCM
QLLAETFPFVDDHESLALDIPSHAESSVFTAPHQAQSLNSSLEAAMTDLSSIEQDMEQVW
QELFSIPELQCLNTENKQLADTTAVPSPEATLTEMDSNYHFYSSISSLEKEVGNCGPHFL
HGFEDSFSSILSTDDASQLTSLDSNPTLNTDFGDEFYSAFIAEPSDGGSMPSSAAISQSL
SELLDGTIEGCDLSLCKAFNPKHAEGTMEFNDSDSGISLNTSPSRASPEHSVESSIYGDP
PPGFSDSEMEELDSAPGSVKQNGPKAQPAHSPGDTVQPLSPAQGHSAPMRESQCENTTKK
EVPVSPGHQKAPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKE
QFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLGHLKDEREKLLREKGENDR
NLHLLKRRLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDTKKN
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgatggacttggagttgccaccgccaggactacagtcccagcaggacatggatttgatt
gacatcctttggaggcaagacatagatcttggagtaagtcgagaagtgtttgactttagt
cagcgacagaaggactatgagctggaaaaacagaaaaaactcgaaaaggaaagacaagag
caactccagaaggaacaggagaaggccttttttgctcagtttcaactggatgaagaaaca
ggagaattcctcccaattcagccggcccagcacatccagacagacaccagtggatccgcc
agctactcccaggttgcccacattcccaaacaagatgccttgtactttgaagactgtatg
cagcttttggcagagacattcccatttgtagatgaccatgagtcgcttgccctggatatc
cccagccacgctgaaagttcagtcttcactgcccctcatcaggcccagtccctcaatagc
tctctggaggcagccatgactgatttaagcagcatagagcaggacatggagcaagtttgg
caggagctattttccattcccgaattacagtgtcttaataccgaaaacaagcagctggct
gatactaccgctgttcccagcccagaagccacactgacagaaatggacagcaattaccat
ttttactcatcgatctcctcgctggaaaaagaagtgggcaactgtggtccacatttcctt
catggttttgaggattctttcagcagcatcctctccactgatgatgccagccagctgacc
tccttagactcaaatcccaccttaaacacagattttggcgatgaattttattctgctttc
atagcagagcccagtgacggtggcagcatgccttcctccgctgccatcagtcagtcactc
tctgaactcctggacgggactattgaaggctgtgacctgtcactgtgtaaagctttcaac
ccgaagcacgctgaaggcacaatggaattcaatgactctgactctggcatttcactgaac
acgagtcccagccgagcgtccccagagcactccgtggagtcttccatttacggagaccca
ccgcctgggttcagtgactcggaaatggaggagctagatagtgcccctggaagtgtcaaa
cagaacggccctaaagcacagccagcacattctcctggagacacagtacagcctctgtca
ccagctcaagggcacagtgctcctatgcgtgaatcccaatgtgaaaatacaacaaaaaaa
gaagttcccgtgagtcctggtcatcaaaaagccccattcacaaaagacaaacattcaagc
cgcttagaggctcatctcacacgagatgagcttagggcaaaagctctccatattccattc
cctgtcgaaaaaatcattaacctccctgttgatgacttcaatgaaatgatgtccaaggag
caattcaatgaagctcagctcgcattgatccgagatatacgcaggagaggtaagaataaa
gtcgccgcccagaactgtaggaaaaggaagctggagaacattgtcgagctggagcaagac
ttgggccacttaaaagacgagagagaaaaactactcagagaaaagggagaaaacgacaga
aacctccatctactgaaaaggcggctcagcaccttgtatcttgaagtcttcagcatgtta
cgtgatgaggatggaaagccttactctcccagtgaatactctctgcagcaaaccagagat
ggcaatgtgttccttgttcccaaaagcaagaagccagatacaaagaaaaactag

DBGET integrated database retrieval system