KEGG   Mus musculus (mouse): 18025Help
Entry
18025             CDS       T01002                                 

Gene name
Nfe2l3, Nrf3
Definition
(RefSeq) nuclear factor, erythroid derived 2, like 3
  KO
K09040  nuclear factor erythroid 2-related factor 1/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18025 (Nfe2l3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    18025 (Nfe2l3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2
Motif
Other DBs
NCBI-GeneID: 18025
NCBI-ProteinID: NP_035033
MGI: 1339958
Ensembl: ENSMUSG00000029832
Vega: OTTMUSG00000034271
UniProt: Q9WTM4 Q3UZC1
Position
6 B3; 6 24.84 cM
AA seq 660 aa AA seqDB search
MKLPKPWWAGGGLLQLTILLSLVGLRVDLDLFLPPPAAALWEELLPLCPTRPASASNPFS
ASEGWERTPLLPAKGRLLHEVRALGVPFIPRTRVDAWLVHSVATGNADGAHGLLGTAASS
AVGDGGQSASAGGGDPRAAHSSPLAAEEEEEKAAEPTAQVPDAGGCGSQENGMLREKSEA
VDHSSQQEENEEGVSAQAKSRQQSKTEEHKMACASAREAEKITEARNESHLHWSDTSFSL
EDLFQLLSSQPEHSLEGISVEDIPPFLSSVCESVNSSAQNINLSQAISHDVNLHEAMLLY
PNNTFRRDPSARSSQAQEPFLQLNPHTNPEQATPAMSLPPFDNQMRNLTSQDLLYDLDSN
IFDGINLMSLATGFSPLEVSQLFEEPDSGLSLNSSYNSTSLTNSYRIYDGTVGYNSDLQS
LCHDLGAVGGCYPEPHKHCHMDHRTIAGFHVSLECQQVFHDHTYHLQSGASEPTSESFAW
SEKSQKTSGCLDNPDRNLSRDEQRAKALHIPFSVDEIVRMPVDSFNSMLSRYYLTDLQVS
LIRDIRRRGKNKVAAQNCRKRKLDIILNLEDDICNLQAKKEALKNEQTQCSKAIDIMRQK
LHGLHQDVFNRLRDDQGRPVNPSQYALQYSHDGTVLIVPKELISSGHKKEAPKGKRERRN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcccgaagccttggtgggcgggcggcggcctcctgcaactcacgattctgttg
agcttggtagggctccgtgtggacctggacctcttcctgccgccgccggccgccgcactt
tgggaagagctgctcccactctgccccacccgccccgcctcggcttctaaccccttctcg
gcttcggaaggctgggaacgcacccccctgctacctgccaaaggccggctgctgcacgaa
gtgcgcgcgctcggggtccccttcattccccgcacccgcgtggacgcgtggctagtgcac
agcgtggcgactgggaacgcagacggggcccacgggctgctcggcaccgccgcctcgtcg
gccgtgggagacggcggccagtcagcatccgcgggcggcggggacccccgagcggctcat
agcagccctctggccgctgaggaagaggaggagaaggcggccgaaccgacggcgcaggtg
ccagatgcaggcggatgcgggagccaggagaacgggatgctaagagaaaagagcgaagct
gtggatcacagttcccagcaggaggaaaacgaggaaggggtgtcagcccaggcaaaatcg
cgacagcagagtaagacggaggaacacaaaatggcgtgtgcctctgccagggaagccgag
aagatcaccgaggctaggaacgagagccatctacattggtcagatacatctttctctttg
gaagatttattccaactactttcatcacagcctgaacattctctggagggcatctcagtg
gaagacattccaccttttctgagcagtgtctgtgaaagtgttaattcctcagcacagaac
ataaatttgagccaagctataagccatgatgtcaatcttcatgaagccatgctgttgtac
cccaacaacacatttagaagagatccatcagcaaggtcttcacaggcacaagaaccattt
ctgcagttaaatcctcatacaaatcctgagcaagccactcctgcaatgtctcttccaccg
tttgacaatcaaatgaggaacctaacaagccaagatctcctgtatgacctggattcaaat
atatttgatggaataaacctaatgtcattggccacaggtttcagtccattggaagtttct
caactttttgaagaaccagattccgggctctcattaaattcaagttacaacagcacctct
ctcacaaattcttaccgtatttatgatgggactgtaggttacaatagcgacctacagtct
ctttgtcatgatttaggtgctgtaggaggctgctacccagaaccccataaacattgtcat
atggaccataggactatagctggctttcatgtgtcccttgaatgtcagcaagtatttcat
gaccacacttaccatttacagtcaggtgcatcagagcccacatctgaatcttttgcatgg
tctgagaagtcgcagaaaaccagtggatgccttgataacccagatagaaacttgagccgt
gatgaacagcgtgctaaagctctgcacattcccttttctgtagatgaaattgtccgtatg
cctgttgactctttcaacagcatgttaagcagatactacctgacagacttacaagtgtct
ctcatccgtgatatcaggcgaagaggaaaaaataaagttgctgctcagaactgccgtaaa
cgtaaactagacatcattttgaatctagaggatgatatatgtaacttgcaagcaaagaaa
gaagcccttaaaaatgagcaaactcaatgtagcaaagctattgacataatgaggcagaag
ctacatggccttcaccaggatgtttttaatagattaagagatgaccaaggtaggccagtc
aatccaagccaatatgcacttcagtacagccatgatggaactgttttgattgtacccaaa
gaactcatctcatcaggccacaaaaaggaagccccaaagggaaagagagagagaagaaac
tga

DBGET integrated database retrieval system