KEGG   Mus musculus (mouse): 18028Help
Entry
18028             CDS       T01002                                 

Gene name
Nfib, 6720429L07Rik, CTF, E030026I10Rik, NF-I/B, NF1-B, NFI-B
Definition
(RefSeq) nuclear factor I/B
  KO
K09169  nuclear factor I/B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18028 (Nfib)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other basic domains
   NF-1
    18028 (Nfib)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTF_NFI NfI_DNAbd_pre-N MH1 DUF3383
Motif
Other DBs
NCBI-GeneID: 18028
NCBI-ProteinID: NP_001106680
MGI: 103188
Ensembl: ENSMUSG00000008575
Vega: OTTMUSG00000000395
UniProt: P97863 Q6GSP7
Position
4 C3; 4 38.4 cM
AA seq 570 aa AA seqDB search
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
LLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDC
LRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFL
AYYVQEQDSGQSGSPSHSDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFP
IGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPNSPAAGS
RTWHERDQDMSSPTTMKKPEKPLFSSTSPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTP
PPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNSSG
QVVGKVPGHFTPVLAPSPHPSAVRPVTLTMTDTKPITTSTEGEAASPTATTYTASGTSQA
NRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQV
SNRTPILPANVQNYGLNIIGEPFLQAETSN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgatgtattctcccatctgtctcactcaggatgaattccacccatttattgaggcactt
cttcctcacgtccgtgcaattgcctatacttggttcaacctgcaggctcgaaaacgcaag
tactttaaaaagcatgagaaacgaatgtcgaaggatgaagaaagggcagtcaaagacgag
ctgctcagtgagaagcccgaaatcaagcagaagtgggcatccaggctcctggccaaactg
cgcaaagatatccgccaggagtaccgggaggactttgtgcttaccgtgactggcaagaag
cacccgtgctgtgtcttatccaatccagaccagaagggtaagattaggaggatcgactgc
ctgcgacaggcagacaaagtctggcgtctggatctagtcatggtgatcctgttcaaaggc
atccctttggagagtacggatggagagcgactcatgaagtccccgcactgcacaaaccca
gcactttgtgttcagccacaccacatcacagtatcagttaaggagcttgacttgtttttg
gcatactacgtgcaggagcaagattctggacaatcaggaagtccaagccacagtgatcct
gccaagaatcctccagggtacctcgaggacagctttgtaaaatccggagtcttcaatgta
tcagagcttgtgagagtatccagaacacccataacccagggaactggagtcaacttccca
atcggagaaattcccagccaaccatactatcatgacatgaactctggtgtgaacctgcag
aggtcgctgtcttctccaccgagcagcaaaagacccaaaactatatctatagatgaaaat
atggagccaagtcctacaggagacttttacccctctccaaattcaccagctgctggaagt
cgaacatggcatgaacgagatcaagatatgtcttctccaactacaatgaagaagcctgag
aagccactgtttagctctacatctccacaggattcttccccaagattgagcactttcccc
cagcaccatcatcccggaatacctggagtcgcgcacagtgtcatctcaactcgaactcca
cctccgccctcaccgttgccatttccgacgcaagctatccttcctccggcaccttccagc
tacttctctcatccaacaatcagatatcctcctcacctgaatcctcaggatactctgaag
aactacgtaccttcttatgacccatccagtcctcaaacgagccagcctaacagcagtggt
caagtagtagggaaagtgcctggccatttcacacctgtcttggcaccctctccccatccc
agtgcagtgcgacctgtgaccctgaccatgacagatactaaacccatcactacatccact
gaaggtgaggcagcttcacctacagcaaccacctacacagcctcaggcacatctcaagcc
aatcgatatgtgggactaagcccaagagacccatccttcctgcatcagcaacagctgagg
atttgtgactggaccatgaatcaaaacggcaggcatttataccccagtaccagtgaggat
acattgggaattacttggcaaagtcctggtacctgggctagcttggttccttttcaagtg
tcaaataggacacccatcttaccggcaaatgtccaaaattatggtttgaacataattgga
gagcctttccttcaagcggagacaagcaactga

DBGET integrated database retrieval system