KEGG   Mus musculus (mouse): 18032Help
Entry
18032             CDS       T01002                                 

Gene name
Nfix, CTF, NF-I/X, NF1-X, NFI-X
Definition
(RefSeq) nuclear factor I/X
  KO
K09171  nuclear factor I/X
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18032 (Nfix)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other basic domains
   NF-1
    18032 (Nfix)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTF_NFI NfI_DNAbd_pre-N MH1
Motif
Other DBs
NCBI-GeneID: 18032
NCBI-ProteinID: NP_001075451
MGI: 97311
Ensembl: ENSMUSG00000001911
Vega: OTTMUSG00000022188
UniProt: P70257 Q5CZY4
Position
8 C2; 8 41.02 cM
AA seq 441 aa AA seqDB search
MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDEL
LGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLA
YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASG
PNFSLADLESPSYYNINQVTLGRRSITSPPSTSSTKRPKSIDDSEMESPVDDVFYPGTGR
SPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPG
SPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHS
QRQAPPLPTGLSASDPGTATF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtactccccgtactgcctcacccaggatgagttccacccgtttatcgaggcgctgctg
cctcacgtccgagccttctcctacacctggttcaacctgcaggcgcggaagcgcaagtac
ttcaagaagcacgagaagcggatgtcaaaggacgaggagcgcgcagtgaaggacgagctg
ctgggcgagaagcctgagatcaagcagaagtgggcatcccggctgttggccaagctgcgc
aaagacatccggcccgagttccgcgaggactttgtgctaaccatcacgggcaagaagccc
ccctgctgcgtgctttccaaccccgaccagaagggcaagatccggcggattgactgcctg
cgccaggctgacaaggtgtggcggctggacctggtcatggtgattttgtttaaagggatc
cctttggaaagtactgatggggagcggctctacaagtcgccccagtgctcgaaccccggc
ctgtgtgtccagccacatcacattggagtcacaatcaaagaactggacctttatctggct
tactttgtccacactccggaatccggacaatcagatagttcaaaccagcaaggagatgcg
gacatcaaaccactgcccaacgggcacttaagtttccaggactgctttgtgacgtctggg
gtctggaatgtgacagagctggtgagagtatcacagactccagttgcgactgcatcaggg
cccaacttctcactggcggacctggagagccccagctactacaacataaatcaagtgacc
ctgggaaggcggtccatcacctcccctccttccaccagcagcaccaagcgccccaagtcc
atcgacgacagtgagatggagagtccagtagatgatgtgttctatcctgggacaggccgc
tctccggccgctggcagcagccagtctagcggatggcccaatgacgtggatgcaggccct
gcttctctaaagaagtcaggaaagctggacttctgcagcgccctctcctctcagggcagt
tccccacgcatggctttcacccaccacccgctgcctgtgcttgctggagtcagaccaggg
agcccccgggccacggcatcagcgctgcacttcccttccacgtccatcatccagcagtcg
agcccgtatttcacacacccaaccatccgctaccaccaccaccatgggcaggactcgctg
aaggagtttgtgcagtttgtgtgctctgacggctcgggtcaggccaccggacagcattca
caacgacaggcgcctcctctgccaaccggtttgtcagcatcggatcccgggacggcaact
ttctga

DBGET integrated database retrieval system