KEGG   Mus musculus (mouse): 18041Help
Entry
18041             CDS       T01002                                 

Gene name
Nfs1, AA987187, m-Nfs1, m-Nfsl
Definition
(RefSeq) nitrogen fixation gene 1 (S. cerevisiae)
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00730  Thiamine metabolism
mmu01100  Metabolic pathways
mmu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    18041 (Nfs1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    18041 (Nfs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    18041 (Nfs1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    18041 (Nfs1)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mmu02048]
    18041 (Nfs1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     18041 (Nfs1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    18041 (Nfs1)
 Prokaryotic type
    18041 (Nfs1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    18041 (Nfs1)
Prokaryotic defense system [BR:mmu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   18041 (Nfs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 18041
NCBI-ProteinID: NP_035041
MGI: 1316706
Ensembl: ENSMUSG00000027618
Vega: OTTMUSG00000016100
UniProt: Q9Z1J3 Q9CTB2
Position
2; 2 H1
AA seq 459 aa AA seqDB search
MVGSVAGNMLLRAAWRRASLAATSLALGRSSVPTRGLRLRVVDHGPHSPVHSEAEAVLRP
LYMDVQATTPLDPRVLDAMLPYLVNYYGNPHSRTHAYGWESEAAMERARQQVASLIGADP
REIIFTSGATESNNIAIKGVARFYRSRKKHLVTTQTEHKCVLDSCRSLEAEGFRVTYLPV
QKSGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGQICSSRKVYFHTDAAQAVG
KIPLDVNDMKIDLMSISGHKLYGPKGVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPT
PLVVGLGAACELAQQEMEYDHKRISKLAERLVQNIMKNLPDVVMNGDPKQHYPGCINLSF
AYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEE
VDYTAEKCIHHVKRLREMSPLWEMVQDGIDLKSIKWTQH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtgggctctgtggctgggaacatgctgctgcgagccgcttggaggcgggcgtcgttg
gcggctacctccttggccctgggaaggtcctcggtgcccacccggggactgcgcctgcgc
gttgtagatcatggcccccattcgcctgttcactcagaggcagaggcagtgctgcgacct
ctctacatggacgtacaggccaccactcctctggatcccagagtgcttgatgccatgctc
ccataccttgtcaactactatgggaaccctcattctcggactcatgcatatggctgggag
agcgaggcagccatggaacgtgctcgccagcaagtagcatctctgattggagctgatcct
cgggagatcattttcactagtggagctactgagtccaacaacatagcaattaagggagtg
gccaggttctacaggtcaaggaaaaaacacttggtcacaacccagacagaacacaaatgt
gtgctggattcctgccgctccctggaagctgagggctttcgggtcacttacctccctgtg
cagaagagcgggatcattgacttaaaggaactagaggctgccatccagccagacaccagc
ctggtctccgttatgactgtgaacaatgaaattggagtaaagcaaccaattgcagaaata
gggcagatttgtagttccagaaaggtgtacttccacactgatgccgcccaagcggttggg
aaaatcccacttgacgtcaatgacatgaagattgatctcatgagcatcagcggtcacaaa
ctctatggccctaaaggggttggtgctatctatatccgccgtaggccccgggtacgtgtg
gaggccctacagagtggaggcgggcaggagcggggtatgcggtctgggacagtgcccaca
cccttggtggtgggcctgggagctgcatgtgagttggcacaacaagagatggaatacgac
cataagcggatctcaaagttagcagagcgactggtacagaacataatgaagaatcttcca
gatgtggtaatgaacggggacccgaagcagcactaccctggctgtatcaacctctccttc
gcgtatgtggaaggagagagcctgctgatggccctcaaggatgtggccttgtcctcaggg
agtgcctgcacttctgcatcattggagccctcttatgtcctcagagcaattggtaccgat
gaggatttagcacactcctctatcaggtttggcatcggccgcttcactacagaagaggag
gtggactacacggcggagaagtgcatccaccacgtgaagcgccttcgagaaatgagtcct
ctctgggagatggtccaggatggcattgacctcaagagcatcaagtggacccagcattag

DBGET integrated database retrieval system