KEGG   Mus musculus (mouse): 18044
Entry
18044             CDS       T01002                                 

Gene name
Nfya, AA407810, Cbf-b, SEZ-10, SEZ10, Sez1
Definition
(RefSeq) nuclear transcription factor-Y alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05017  Spinocerebellar ataxia
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    18044 (Nfya)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    18044 (Nfya)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    18044 (Nfya)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18044 (Nfya)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    18044 (Nfya)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 18044
NCBI-ProteinID: NP_001334330
MGI: 97316
Ensembl: ENSMUSG00000023994
Vega: OTTMUSG00000035112
UniProt: P23708
Position
17 C; 17 23.99 cM
AA seq 346 aa
MEQYTTNSNSSTEQIVVQAGQIQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLM
VQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQ
VQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQ
QVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVP
GAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHE
SRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagcagtatacgacaaacagcaatagttccacagagcagatcgtggtgcaggccggc
cagattcagcagcagcagggtggtgtcactgctgtccagctgcagactgaggcccaggtg
gcatccgcctcaggccagcaagtccagaccctccaggtagtccaggggcagccgttaatg
gtgcaagtcagtggaggccagcttattacatcaacaggccaacccatcatggtacaggct
gtgcctggtggacaaggccaaaccatcatgcaagtacctgtgtctggaacacaaggttta
cagcagatacagttggtgcctcctggacagatccagattcagggtgggcaggctgtgcag
gtgcaaggccagcagggtcaaacccagcagatcatcatccaacagccacagactgcagtc
actgctggccagactcagacacaacaacagattgctgtccagggacagcaagtggcccag
actgctgaaggacagactattgtctaccaaccagttaatgcagatggcacaattctccag
caagttacagtccctgtttcaggcatgatcaccatcccagcagccagtttggcaggggca
cagatcgttcagacaggagccaataccaacacaaccagcagtggacaagggacggtcact
gtgacactgcctgtggcagggaatgtggtcaactcaggaggaatggtcatgatggtacca
ggagctggctctgtgcctgctatccaaagaatccctttacctggagcagagatgctggaa
gaagagcccctgtatgtgaatgccaaacagtatcaccgcatccttaagaggagacaagca
cgggctaagctagaggcagaagggaaaatcccaaaggaacgaaggaaatacctccatgag
tctcggcatcggcacgccatggcacggaagcgtggggaagggggccgcttcttctctcca
aaagaaaaggacagtcctcacatgcaggatccaaaccaagctgacgaagaagccatgaca
cagatcatccgagtttcctaa

DBGET integrated database retrieval system