KEGG   Mus musculus (mouse): 18044
Entry
18044             CDS       T01002                                 

Gene name
Nfya, AA407810, Cbf-b, SEZ-10, SEZ10, Sez1
Definition
(RefSeq) nuclear transcription factor-Y alpha
  KO
K08064  nuclear transcription factor Y, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05017  Spinocerebellar ataxia
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    18044 (Nfya)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    18044 (Nfya)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    18044 (Nfya)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18044 (Nfya)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    18044 (Nfya)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
NCBI-GeneID: 18044
NCBI-ProteinID: NP_001334330
MGI: 97316
Ensembl: ENSMUSG00000023994
Vega: OTTMUSG00000035112
UniProt: P23708
Position
17 C; 17 23.99 cM
AA seq 346 aa
MEQYTTNSNSSTEQIVVQAGQIQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLM
VQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQ
VQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQ
QVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVP
GAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHE
SRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagcagtatacgacaaacagcaatagttccacagagcagatcgtggtgcaggccggc
cagattcagcagcagcagggtggtgtcactgctgtccagctgcagactgaggcccaggtg
gcatccgcctcaggccagcaagtccagaccctccaggtagtccaggggcagccgttaatg
gtgcaagtcagtggaggccagcttattacatcaacaggccaacccatcatggtacaggct
gtgcctggtggacaaggccaaaccatcatgcaagtacctgtgtctggaacacaaggttta
cagcagatacagttggtgcctcctggacagatccagattcagggtgggcaggctgtgcag
gtgcaaggccagcagggtcaaacccagcagatcatcatccaacagccacagactgcagtc
actgctggccagactcagacacaacaacagattgctgtccagggacagcaagtggcccag
actgctgaaggacagactattgtctaccaaccagttaatgcagatggcacaattctccag
caagttacagtccctgtttcaggcatgatcaccatcccagcagccagtttggcaggggca
cagatcgttcagacaggagccaataccaacacaaccagcagtggacaagggacggtcact
gtgacactgcctgtggcagggaatgtggtcaactcaggaggaatggtcatgatggtacca
ggagctggctctgtgcctgctatccaaagaatccctttacctggagcagagatgctggaa
gaagagcccctgtatgtgaatgccaaacagtatcaccgcatccttaagaggagacaagca
cgggctaagctagaggcagaagggaaaatcccaaaggaacgaaggaaatacctccatgag
tctcggcatcggcacgccatggcacggaagcgtggggaagggggccgcttcttctctcca
aaagaaaaggacagtcctcacatgcaggatccaaaccaagctgacgaagaagccatgaca
cagatcatccgagtttcctaa

KEGG   Mus musculus (mouse): 18045
Entry
18045             CDS       T01002                                 

Gene name
Nfyb, AA985999, Cbf-, Cbf-A
Definition
(RefSeq) nuclear transcription factor-Y beta
  KO
K08065  nuclear transcription Y subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05152  Tuberculosis
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    18045 (Nfyb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18045 (Nfyb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    18045 (Nfyb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18045 (Nfyb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    18045 (Nfyb)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TFIID-18kDa CENP-T_C TFIID_20kDa PAN_3
Other DBs
NCBI-GeneID: 18045
NCBI-ProteinID: NP_035044
MGI: 97317
Ensembl: ENSMUSG00000020248
Vega: OTTMUSG00000032747
UniProt: P63139 Q8C590
Position
10 C1; 10 40.25 cM
AA seq 207 aa
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVSATDGLSEELTEEAFTNQLPAGLIT
ADGQQQNVMVYTTSYQQISGVQQIQFS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacaatggacggcgacagctccaccacagatgcctcccagctagggatttctgcagac
tacatcggaggaagtcattatgtgatccagccccatgatgatactgaggacagcatgaat
gatcatgaagatacaaatggttcaaaagaaagtttcagagaacaagatatttatcttcca
attgcaaatgtggctaggataatgaaaaatgccatacctcaaacaggaaagatcgcaaaa
gatgccaaagaatgtgttcaggaatgtgtgagtgaatttataagcttcatcacgtcggaa
gcaagcgaaaggtgtcatcaggagaagcggaagacaatcaatggggaggatattctgttt
gccatgtccactctaggctttgacagctacgtggagcctctgaaactgtaccttcagaag
ttcagagaggccatgaaaggagagaagggtatcgggggagcagtctccgccacagatgga
ctaagcgaagagctcacggaagaggcattcactaaccagttaccagctggcttaataact
gcagatggtcaacagcaaaacgttatggtttacacaacgtcttaccaacagatttctggt
gtccagcaaattcagttttcatga

KEGG   Mus musculus (mouse): 18046
Entry
18046             CDS       T01002                                 

Gene name
Nfyc
Definition
(RefSeq) nuclear transcription factor-Y gamma
  KO
K08066  nuclear transcription factor Y, gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    18046 (Nfyc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    18046 (Nfyc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18046 (Nfyc)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    18046 (Nfyc)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X
Other DBs
NCBI-GeneID: 18046
NCBI-ProteinID: NP_001041633
MGI: 107901
Ensembl: ENSMUSG00000032897
Vega: OTTMUSG00000008852
UniProt: P70353 Q7TPS7
Position
4 D2.1; 4 56.52 cM
AA seq 335 aa
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQTQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQ
IQQVTMPAGQDLAQPMFIQSANQPSDGQTPQVTGD
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtccacagaaggagggtttggcggtaccagcagcagtgatgcccagcaaagcctccag
tccttctggcccagagtcatggaagaaatccgaaacttaacagtgaaagatttccgagta
caggaactcccactggctcgtattaagaagattatgaaactggatgaagatgtgaagatg
atcagtgcagaagcccctgtgctgtttgctaaggcagcccagatttttatcactgagctg
actcttcgagcctggatccacacagaggataacaagcgtcgtactcttcagaggaatgat
attgccatggcaattacaaaatttgatcagttcgactttctcatcgatattgttccaaga
gatgaactgaaacctccaaagcgccaggaggaggtacgccagtctgtgactcctgcggag
cctgtccagtactacttcacgctggctcagcagcccactgctgtccaggtccagggacag
cagcaaggccagcagaccaccagttctacgaccaccatccagcctggacagatcatcatt
gcacagcctcagcagggtcagaccacacccgtgaccatgcaggttggagaaggtcagcag
gtgcagattgtacaggcccaacctcagggtcaggcccagcagacccagagtggcactgga
cagaccatgcaggtgatgcagcagatcattaccaacacaggagagatccagcagatcccg
gtgcagctgaatgctggccagctgcaatatatccgattagcccagcctgtatcaggcacc
caagttgtccaaggacagatccagacacttgctaccaatgcccaacagatcacacagaca
gaggtccagcaaggacagcagcagttcagccagttcacagatggacagcagctgtaccag
atccagcaagtcaccatgcctgcaggccaagacctcgcccagcccatgtttattcagtca
gccaatcagccctctgatgggcagaccccccaggtgactggagactga

DBGET integrated database retrieval system