KEGG   Mus musculus (mouse): 18049Help
Entry
18049             CDS       T01002                                 

Gene name
Ngf, Ngfb, beta-NGF
Definition
(RefSeq) nerve growth factor
  KO
K02582  nerve growth factor, beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18049 (Ngf)
   04015 Rap1 signaling pathway
    18049 (Ngf)
   04010 MAPK signaling pathway
    18049 (Ngf)
   04151 PI3K-Akt signaling pathway
    18049 (Ngf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18049 (Ngf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18049 (Ngf)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18049 (Ngf)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18049 (Ngf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    18049 (Ngf)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18049 (Ngf)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   18049 (Ngf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18049 (Ngf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 18049
NCBI-ProteinID: NP_001106168
MGI: 97321
Ensembl: ENSMUSG00000027859
Vega: OTTMUSG00000054689
UniProt: P01139
Structure
PDB: 

Position
3 F2.2; 3 45.25 cM
AA seq 241 aa AA seqDB search
MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIA
ARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSK
RSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCR
ASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRR
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcactgcgtttttgatcggcgtacaggcagaaccg
tacacagatagcaatgtcccagaaggagactctgtccctgaagcccactggactaaactt
cagcattcccttgacacagccctccgcagagcccgcagtgcccctactgcaccaatagct
gcccgagtgacagggcagacccgcaacatcactgtagaccccagactgtttaagaaacgg
agactccactcaccccgtgtgctgttcagcacccagcctccacccacctcttcagacact
ctggatctagacttccaggcccatggtacaatccctttcaacaggactcaccggagcaag
cgctcatccacccacccagtcttccacatgggggagttctcagtgtgtgacagtgtcagt
gtgtgggttggagataagaccacagccacagacatcaagggcaaggaggtgacagtgctg
gccgaggtgaacattaacaacagtgtattcagacagtacttttttgagaccaagtgccga
gcctccaatcctgttgagagtgggtgccggggcatcgactccaaacactggaactcatac
tgcaccacgactcacaccttcgtcaaggcgttgacaacagatgagaagcaggctgcctgg
aggttcatccggatagacacagcctgtgtgtgtgtgctcagcaggaaggctacaagaaga
ggctga

DBGET integrated database retrieval system