KEGG   Mus musculus (house mouse): 18053
Entry
18053             CDS       T01002                                 
Symbol
Ngfr, LNGFR, Tnfrsf16, p75, p75NGFR, p75NTR
Name
(RefSeq) nerve growth factor receptor (TNFR superfamily, member 16)
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04215  Apoptosis - multiple species
mmu04722  Neurotrophin signaling pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18053 (Ngfr)
   04014 Ras signaling pathway
    18053 (Ngfr)
   04015 Rap1 signaling pathway
    18053 (Ngfr)
   04151 PI3K-Akt signaling pathway
    18053 (Ngfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18053 (Ngfr)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    18053 (Ngfr)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18053 (Ngfr)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18053 (Ngfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    18053 (Ngfr)
   04090 CD molecules [BR:mmu04090]
    18053 (Ngfr)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   18053 (Ngfr)
CD molecules [BR:mmu04090]
 Proteins
  18053 (Ngfr)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 18053
NCBI-ProteinID: NP_150086
MGI: 97323
Ensembl: ENSMUSG00000000120
Vega: OTTMUSG00000001661
UniProt: Q9Z0W1
Position
11:complement(95459644..95478524)
AA seq 427 aa
MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPC
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDE
ETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQL
RECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSE
STATSPV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaggagggcaggtgctgcctgcagcgccatggaccggctgcgcctgctgctgctgctg
ctgctgcttctaggggtgtcctttggaggtgccaaggagacatgttccacaggcatgtac
acccacagtggagagtgctgcaaagcctgcaacctgggcgaaggtgtggcccagccttgc
ggagccaaccagaccgtgtgtgaaccctgcctggacagtgttacgttctctgacgtggtg
agcgccaccgagccgtgcaagccgtgcaccgagtgcctgggcctgcagagtatgtccgct
ccctgtgtggaggcagacgatgccgtgtgccgatgctcctatggctactaccaggacgag
gagactggccgctgcgaggcttgcagcgtgtgcggggtgggctcaggactcgtgttctcc
tgccaggacaaacagaacacagtgtgtgaagagtgcccagagggcacatactcagatgaa
gccaaccacgtggacccgtgcctaccctgcacggtgtgcgaggacactgagcgccagtta
cgcgagtgcacgccctgggctgacgccgaatgcgaggagatccctggccgatggatcaca
aggtctacgcccccggagggctctgacgtcacaacacccagcacccaggagccggaggca
cctccagagcgagacctcatagccagcacagtggccgatacggtgaccactgtgatgggc
agctcccagcctgtagtgacccgaggcaccgctgacaacctcattcctgtctattgctcc
atcttggctgctgtggttgtgggccttgtggcctatattgctttcaagagatggaacagc
tgcaagcaaaataaacaaggagccaacagccggccggtgaaccagacacccccaccagag
ggagagaaactgcacagcgacagcggcatctctgtggacagccagagcctgcacgaccag
cagacccacacacagactgcctcaggccaagccctcaagggtgatggcaacctctacagt
agcctgcccctgaccaagcgtgaggaggtcgagaagctgctcaatggtgacacctggcga
catctggcaggcgagctgggctaccagccggagcatatagactcctttacccacgaggcc
tgcccagtccgagccctgctggccagctggggtgcccaggacagcgcgacgctcgatgcc
cttttagccgccctgcgacgcatccagagagctgacattgtggagagcctgtgcagcgag
tccactgccacgtcccctgtgtga

DBGET integrated database retrieval system