KEGG   Mus musculus (mouse): 18074Help
Entry
18074             CDS       T01002                                 

Gene name
Nid2, AW547149, Ly111, NID-2, entactin-2, nidogen-2
Definition
(RefSeq) nidogen 2
  KO
K06826  nidogen (entactin)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    18074 (Nid2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G2F Thyroglobulin_1 Ldl_recept_b EGF_3 EGF_CA NIDO cEGF EGF hEGF SGL FXa_inhibition EGF_MSP1_1
Motif
Other DBs
NCBI-GeneID: 18074
NCBI-ProteinID: NP_032721
MGI: 1298229
Ensembl: ENSMUSG00000021806
UniProt: O88322 Q8C6Z2 Q3TPN0 Q8R5G0
Position
14; 14 A3
AA seq 1403 aa AA seqDB search
MFRDPTAGWLTPPSPLSLLVMLLLLSRVGALRPDELFPYGESWGDQLLPEGDDESSAAVK
LAIPLRFYDAQFSSLYVGTNGIISTQDFPRETQYVDDDFPTDFPAIAPFLADIDTSHSRG
RILYREDTSGAVLSLAARYVRTGFPLSGSSFTPTHAFLATWEHVGAYEEVSRGAAPSGEL
NTFQAVLASDESDTYALFLYPANGLQFFGTRPKESYNVQLQLPARVGFCRGEADDLKREA
LYFSLTNTEQSVKNLYQLSNLGIPGVWAFHIGSRFALDNVRPATVGGDPSTARSSALEHP
FSHAAALESYTEDSFHYYDENEEDVEYPPVEPGEAPEGHSRIDVSFNSKADPGLVDVGTS
SPGSDRASPWPYPAPGNWPSYRETESASLDPQTKQGRPVGEGEVLDFRDPAELLDQMGTR
APAPPEADAALLTPVNEDLGGRNTQSYPEAGPVPSEPDVPVPPLEGEVLPHYPESGHVPP
LRGGKYVIGLEDHVGSNDQVFTYNGANLETCEHSHGRCSQHAFCTDYTTGFCCHCQSRFY
GNGKHCLPEGAPHRVNGKVSGRLRVGHIPVHFTDVDLHAYIVGNDGRAYTAISHVPQPAA
QALLPVLPIGGLFGWLFALEKPGSENGFSLTGATFVHDVEVTFHPGEERVRITQTAEGLD
PENYLSIKTNIEGQVPFIPANFTAHITPYKEFYHYRDSVVTSSSSRSFSLTSGSINQTWS
YHIDQNITYQACRHAPRHLAIPATQQLTVDRAFALYSEDEGVLRFAVTNQIGPVEVDSAP
VGVNPCYDGSHTCDTTARCHPGTGVDYTCECTPGFQGDGRSCVDVNECATGFHRCGPNSV
CVNLVGSYRCECRSGYEFADDQHTCILIAPPPNPCLDGSHTCAPEGQARCIHHGGSSFSC
ACLPGFIGTGHQCSDVDECAENRCHEAAICYNTPGSFSCRCQPGYRGDGFHCTSDTVPED
SISGLKPCEYQQRYAQTQHAYPGSRIHIPQCDDQGNFVPLQCHGSTGFCWCVDRNGHEVP
GTQTPPGSTPPHCGPPPEPTQRPRTVCERWRESLLEHYGGTPRDDQYVPQCDDLGHFIPL
QCHGKSDFCWCVDKDGRELQGTRSQPGTRPACIPTVAPPVVRPTPRPDVTPPSVGTFLLY
AQGQQIGHLPLNGSRLQKDAARTLLSLHGSIVVGIDYDCRERMVYWTDVAGRTISRASLE
AGAEPETIITSGLISPEGLAIDHFRRTMYWTDSGLDKIERAELDGSERKVLFHTDLVNPR
AITVDPIRGNLYWTDWNREAPKIETSSLDGENRRILINKDIGLPNGLTFDPFSKLLCWAD
AGTKKLECTLPDGTGRRVIQNHLNYPFSIVSYADHFYHTDWRRDGVISVNKDSGQFTDEF
LPEQRSHLYGITAVYPYCPTGRK
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgggacccgacagccgggtggctaacaccgccatcaccgctatcgctgctggtg
atgctgttgctgctgtcgcgagtcggggctctgcgtcccgacgagctctttccttacggg
gagtcgtggggagaccagctgctgccggagggcgacgacgaaagctcagcagctgtgaag
ctggcaatacccctgcgtttctacgatgcccagttcagcagcctctacgtgggcaccaac
ggcatcatctccacccaggacttccccagggagactcaatatgtagatgatgattttcct
actgacttcccagccatcgcccctttcctggctgacatcgacactagtcacagcaggggc
cggatcctgtaccgcgaggacacctccggagctgtgctgagcctggctgcccgctacgtg
cgcactggcttcccgctgtcggggtccagcttcacccccacccacgccttcctggccacc
tgggagcacgtgggcgcctacgaggaggtcagtcgcggggctgcgccgtcaggagagctg
aacactttccaggctgttctggcatccgatgaatctgatacctacgccctctttctctac
cctgccaatggccttcagttctttggaacccgccccaaagagtcctacaatgtccagctg
cagcttcccgctagggtgggcttctgccgaggggaagcggacgacctgaagagagaagca
ctgtatttcagcctgactaacaccgagcagtctgtgaagaatctctaccagctaagcaac
ctggggattcctggagtgtgggcttttcacatcggcagcaggtttgccctggacaatgtc
cgtccagccacagttggaggtgacccttccacagcccgttcctcagcactggagcacccc
ttcagccatgctgcagccctggagagctacaccgaggacagtttccattactacgatgag
aatgaagaggatgttgagtacccaccagttgaaccgggggaggccccggaaggccacagc
agaattgatgtgtctttcaattcaaaggctgatccaggccttgtggacgtcggcacctca
tctccaggttccgaccgcgcttctccttggccatatccagcacctggtaactggccatcc
taccgggaaacagaatcggcttctttggaccctcaaaccaaacaggggcggccggtggga
gagggagaggttctggatttcagggacccagcggagcttttggaccagatgggtaccaga
gccccagctcctccagaggcagatgcagctctcctaactccagtcaacgaagaccttggg
ggcagaaacacccagtcctatccagaggcagggccagtgccttcagagccagatgttcct
gtccctcctctggaaggagaagtccttcctcattaccccgagtctggtcacgttccgccc
ctgagaggagggaagtatgtgataggactggaggaccacgtgggatctaatgatcaagtc
ttcacgtataatggcgccaacctggaaacctgcgaacacagccacggccggtgctcccag
catgccttctgcaccgactacaccactggcttttgctgccactgccagtcgaggttttac
ggaaacgggaagcactgcctgccagaaggggcacctcaccgagtgaatgggaaagtgagt
ggtcgcctccgagtgggtcacattcctgtgcacttcactgacgtggatctacacgcttac
atcgtgggcaatgatggcagagcctacactgccatcagccatgtcccacagccggcagcc
caggccctgctccctgtcctgcccattggaggtctgtttggctggctctttgctttggag
aagccaggctctgagaatggcttcagcctcacaggtgctacctttgtccatgacgtggaa
gtcacttttcaccctggagaggagagggttcgtatcactcaaactgccgaggggcttgac
ccagaaaactatctgagcattaagaccaacattgaaggccaggtgcccttcatcccagcg
aatttcacagcccacattactccgtacaaagagttttatcattacagggactcagtcgtg
acgtcctccagttcccgaagtttctctctcacttctggttctattaaccaaacgtggtcc
taccacattgaccagaacatcacttaccaggcgtgcaggcacgcccccagacacctggcc
atccctgccacccagcagctgactgtcgaccgggcctttgctttgtacagtgaggatgag
ggcgtgctgaggtttgctgtgaccaatcagattggccctgttgaagtggactcagcccct
gttggagtgaatccttgctacgacggaagccacacctgtgacacaacagcaaggtgccac
ccgggaacaggtgtagactacacctgcgagtgcacgcctgggttccagggtgacggacgg
agctgtgtggatgtcaatgagtgtgccactggcttccaccgctgtggccctaattctgtg
tgtgtcaacttggtgggaagctacaggtgtgaatgccgcagtggctatgaatttgcagat
gaccagcacacttgtatcttgatcgccccacctcccaacccttgcctcgatggcagtcac
acctgtgcccctgaggggcaagccaggtgcattcaccatggaggcagctcattcagttgt
gcctgcctgccaggcttcattggcactgggcatcagtgttctgatgttgatgaatgtgcg
gaaaaccgatgtcatgaggcagctatctgctacaatacccccgggtccttctcctgccgt
tgccagcctgggtatcgaggggacgggtttcactgcacctctgacacggttccggaagat
tccatctcaggactgaagccctgtgaataccagcagcgctatgctcagacacagcacgcc
taccctgggtcacggatccacatcccccagtgtgatgaccagggaaacttcgtgccactg
cagtgccacggcagcactggcttctgctggtgtgtggaccgaaatggccacgaagtccct
ggcacgcagactccacccggctccaccccgccccactgtggaccacctccagagcccacc
cagaggcctcggactgtctgtgagcgttggcgggaaagcctgctggaacactacggaggc
acacccagggatgaccagtatgtgccccagtgtgatgacctgggccacttcatccccctg
cagtgccatggaaagagtgatttctgttggtgtgtggacaaggatggcagagagctacag
ggcacgcgctcacagccaggcaccaggcctgcatgcatacccaccgtcgctccacccgtg
gtccggcccacaccccggcccgatgtgactcctccatctgtgggcaccttcctgctctat
gcccagggccaacagattggccacttgcccctcaatggcagcaggcttcagaaggacgca
gcccggaccctgctgtcactgcatggctccatagttgtggggattgactatgactgccgg
gagaggatggtctactggacagacgttgctggtcggaccatcagccgtgccagcttggag
gcaggagccgaacccgagaccatcattacctcaggtttgataagcccggaaggacttgcc
atcgaccacttccgtagaacaatgtactggacagatagtggcctggataagatagagcgg
gccgaactggatggttccgagcggaaagtcctcttccacacagatctggtgaatccacga
gccatcactgtggatccaatccgaggcaacttgtactggacagactggaatagagaagct
cctaaaattgaaacatcatctttagatggcgaaaacagaaggattctgatcaacaaagat
attggattacccaatggattgacctttgaccccttctccaaactgctctgctgggcagat
gcaggaaccaaaaaactggagtgtacactacccgatggaactggacgacgtgtcatccaa
aaccacctcaattaccccttcagcatcgtcagctatgcagatcacttctaccacacggac
tggcggagggatggtgttatatcagtgaataaggacagtggccagtttactgatgagttt
ctccctgagcagcggtctcatctctatgggatcactgcagtctacccgtactgtccaaca
ggaagaaaatga

DBGET integrated database retrieval system