KEGG   Mus musculus (mouse): 18091Help
Entry
18091             CDS       T01002                                 

Gene name
Nkx2-5, Csx, Nkx-2.5, Nkx2.5, tinman
Definition
(RefSeq) NK2 homeobox 5
  KO
K09345  homeobox protein Nkx-2.5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18091 (Nkx2-5)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    18091 (Nkx2-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 18091
NCBI-ProteinID: NP_032726
MGI: 97350
Ensembl: ENSMUSG00000015579
Vega: OTTMUSG00000037537
UniProt: P42582 Q3UQU2
Position
17 A3.3; 17 13.6 cM
AA seq 318 aa AA seqDB search
MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEA
AASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVE
LDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQ
VKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDPAAYAPAYGVG
LNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAASANSNFVNFGVGDLNTVQSP
GMPQGNSGVSTLHGIRAW
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttccccagccctgcgctcacacccacgcctttctcagtcaaagacatcctgaacctg
gagcagcagcagcgtagcctggcgtctggggacctgtctgcgcgcctcgaggccaccctg
gcccctgcctcctgcatgctggccgccttcaagcccgaggcctactctggccccgaggcg
gcagcgtccggcctggcagagctgcgcgcggagatgggccccgcgccttcgccccccaag
tgctctcctgctttcccagccgcccccacattttacccgggagcctacggtgaccctgac
ccagccaaagaccctcgggcggataaaaaagagctgtgcgcgctgcagaaggcagtggag
ctggacaaagccgagacggatggcgccgagagaccacgcgcacggcggcgacggaagcca
cgcgtgctcttctcgcaggcgcaggtctacgagctggagcggcgcttcaagcaacagcgg
tacctgtcggcgccagagcgcgaccagctggccagcgtgctgaagctcacgtccacgcag
gtcaagatctggttccagaaccgtcgctacaagtgcaagcgacagcggcaggaccagact
ctggagcttctggggccgccgccgccgcccgcgcgcaggatcgcggtgcccgtgctggtg
cgcgacgggaagccctgcctgggggaccccgcggcctacgctcccgcctacggcgtgggt
ctcaatgcctatggctacaacgcctacccctaccccagctacggcggcgcggcctgcagt
cccggctacagctgcgccgcctaccccgctgcgccccccgccgcgcagccccccgccgcc
tccgccaacagcaacttcgtgaactttggcgtcggggacttgaacaccgtgcagagtccc
gggatgccgcagggcaattcgggcgtctccacgctgcacggcatccgagcctggtag

DBGET integrated database retrieval system