KEGG   Mus musculus (mouse): 18096
Entry
18096             CDS       T01002                                 

Gene name
Nkx6-1, NKX, NKX6A, Nkx6., Nkx6.1
Definition
(RefSeq) NK6 homeobox 1
  KO
K08030  homeobox protein Nkx-6.1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    18096 (Nkx6-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18096 (Nkx6-1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    18096 (Nkx6-1)
SSDB
Motif
Pfam: Homeodomain PKK
Other DBs
NCBI-GeneID: 18096
NCBI-ProteinID: NP_659204
MGI: 1206039
Ensembl: ENSMUSG00000035187
Vega: OTTMUSG00000037547
UniProt: Q99MA9
Position
5; 5 E4- E5
AA seq 365 aa
MLAVGAMEGPRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPTGPPSSSSSSSSSSSP
SPPLGSHNPGGLKPPAAGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASP
SGSSSSSSSSASATSASAAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSP
SAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHT
RPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEM
ATAKKKQDSETERLKGTSENEEDDDDYNKPLDPNSDDEKITQLLKKHKSSGGSLLLHASE
AEGSS
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgttagctgtgggggcgatggagggccctcggcagagcgcgttcctgctcagcagcccg
cccctggccgccctgcacagtatggccgagatgaagaccccgctctaccccgccgcttat
cccccgctgcccaccgggcccccctcctcctcgtcctcgtcctcctcgtcctcgtcgccc
tccccacctttgggctcacataacccgggcggcttgaagcccccggccgcggggggcctc
tcgtccctgggcagtcccccgcagcagctttcggcggccaccccacacggcatcaacgac
atcctgagccggccctctatgccggtggcctcgggggccgccctgccctccgcctcgccc
tccgggtcttcctcctcctcctcctcgtccgcctccgccacctcggcctctgcggcggcc
gccgccgccgctgctgctgccgccgctgccgcctcgtcgcccgctgggctgctggccggc
ctgccccgcttcagcagcctgagccctccgccaccgccgcccgggctctactttagcccc
agcgccgcggctgtggccgccgtgggccggtaccccaagcccctggccgagctgcccggt
cggacgcccatcttctggcccggagtgatgcagagtccgccgtggagggacgcgcgcctt
gcctgtaccccccatcaaggatccattttgttggacaaagatgggaagagaaaacacacc
agacccacgttctctggacagcaaatcttcgccctggagaagactttcgaacaaacgaag
tacttggcaggaccagagagagcacgcttggcctattctctggggatgacggagagtcag
gtcaaggtctggttccagaaccgcaggaccaagtggagaaagaagcacgcagccgagatg
gccacggccaagaagaagcaggactcggagaccgagaggctcaaggggacttcggagaat
gaggaggatgacgacgattacaacaaacctctggacccgaactctgacgacgagaaaatc
actcagctgctgaaaaagcacaaatcgagcggtggcagcctcctgctgcacgcgtcggag
gccgagggctcgtcctga

DBGET integrated database retrieval system