KEGG   Mus musculus (mouse): 18099Help
Entry
18099             CDS       T01002                                 

Gene name
Nlk, AI194375
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04068  FoxO signaling pathway
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18099 (Nlk)
   04310 Wnt signaling pathway
    18099 (Nlk)
   04068 FoxO signaling pathway
    18099 (Nlk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    18099 (Nlk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18099 (Nlk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     18099 (Nlk)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   18099 (Nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 18099
NCBI-ProteinID: NP_032728
MGI: 1201387
Ensembl: ENSMUSG00000017376
Vega: OTTMUSG00000000149
UniProt: O54949 Q3TV73
Position
11; 11 B5
AA seq 527 aa AA seqDB search
MSLCGTRANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagctgcagcaggtcaccaccaccaccatcatcaccaccttccacaccttcctcct
cctcaccttcaccaccaccaccaccctcaacaccaccttcatccggggtcggctgctgcc
gtacacccagtccagcagcatacgtcttcggcagctgcggcagccgccgcagcagctgca
gccgcagccatgttaaaccctgggcaacaacagccatatttcccatccccggcaccgggt
caggctcctgggccagccgcagcagccccagctcaggtacaggctgctgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccgcaacagcagctggacattgagccg
gatagaccaattggatatggagcctttggcgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agagtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgatctacataaaattatcgtctctcctcagccactcagctcggatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttgcatcgagacattaagccagggaacctccttgtgaacagcaattgtgttctaaagatt
tgtgattttggattggccagagtggaggaattggatgaatcccgtcatatgactcaggaa
gtagttactcagtattaccgggctccggagatcctgatgggcagccgtcattacagcaat
gctatcgacatctggtctgtcgggtgcatctttgcagagctactgggccgaagaatattg
tttcaggcgcagagtcccattcagcagttggatttgatcacagatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggtgctaaggcacacatactcaggggtcct
cataaacagccatctcttcctgtgctctacaccctctccagccaggccacacatgaagct
gttcacctgctttgcaggatgttggtctttgatccatcaaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcggctgagataccatacgtgtatgtgcaag
tgctgcttttccacctcaacggggagagtctacaccagtgactttgagcctgtcaccaac
cccaaatttgatgacacctttgagaagaacctcagctctgtccgacaggttaaagaaatt
atccaccagttcattctggaacagcagaaaggaaacagagtgcctctctgcatcaacccg
cagtccgctgcctttaagagctttattagttccaccgtcgctcagccgtctgagatgccg
ccgtctcctctggtgtgggagtga

DBGET integrated database retrieval system