KEGG   Mus musculus (mouse): 18106
Entry
18106             CDS       T01002                                 

Gene name
Cd244a, 2B4, C9.1, Cd244, F730046O15Rik, Ly90, NAIL, NKR2B4, Nm, Nmrk, SLAMF4
Definition
(RefSeq) CD244 molecule A
  KO
K06582  natural killer cell receptor 2B4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    18106 (Cd244a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18106 (Cd244a)
CD molecules [BR:mmu04090]
 Proteins
  18106 (Cd244a)
SSDB
Motif
Pfam: Receptor_2B4 I-set V-set Ig_2 Ig_3 ig LapA_dom
Other DBs
NCBI-GeneID: 18106
NCBI-ProteinID: NP_061199
MGI: 109294
Ensembl: ENSMUSG00000004709
Vega: OTTMUSG00000016914
UniProt: Q07763
Structure
PDB: 
2PTT 2PTU 1Z2K

Position
1 H3; 1 79.52 cM
AA seq 397 aa
MLGQAVLFTTFLLLRAHQGQDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGS
HRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCN
KNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNST
HWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNFRFLPFGVIIVILVTLFLG
AIICFCVWTKKRKQLQFSPKEPLTIYEYVKDSRASRDQQGCSRASGSPSAVQEDGRGQRE
LDRRVSEVLEQLPQQTFPGDRGTMYSMIQCKPSDSTSQEKCTVYSVVQPSRKSGSKKRNQ
NSSLSCTVYEEVGNPWLKAHNPARLSRRELENFDVYS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgttggggcaagctgtcctgttcacaacctttctgctcctcagggctcatcagggccaa
gactgcccagattcttctgaagaagtggttggtgtctcaggaaagcctgtccagctgagg
ccttccaacatacagacaaaagatgtttctgttcaatggaagaagacagaacagggctca
cacagaaaaattgagatcctgaattggtataatgatggtcccagttggtcaaatgtatct
tttagtgatatctatggttttgattatggggattttgctcttagtatcaagtcagctaag
ctgcaagacagtggtcactacctgctggagatcaccaacacaggcggaaaagtgtgcaat
aagaacttccagcttcttatacttgatcatgttgagacccctaacctgaaggcccagtgg
aagccctggactaatgggacttgtcaactgtttttgtcctgcttggtgaccaaggatgac
aatgtgagctacgctttgtacagagggagcactctgatctccaatcaaaggaatagtacc
cactgggagaaccagattgacgccagcagcctgcacacatacacctgcaacgttagcaac
agagccagctgggcaaaccacaccctgaacttcacccatggctgtcaaagtgtcccttcg
aatttcagatttctgccctttggggtgatcatcgtgattctagttacattatttctcggg
gccatcatttgtttctgtgtgtggactaagaagaggaagcagttacagttcagccctaag
gaacctttgacaatatatgaatatgtcaaggactcacgagccagcagggatcaacaagga
tgctctagggcctctggatctccctcggctgtccaggaagatgggaggggacaaagagaa
ttggacaggcgtgtttctgaggtgctggagcagttgccacagcagactttccctggagat
agaggcaccatgtactctatgatacagtgcaagccttctgattccacatcacaagaaaaa
tgtacagtatattcagtagtccagccttccaggaagtctggatccaagaagaggaaccag
aactcttccttaagttgtaccgtgtacgaggaggttggaaacccatggctcaaagctcac
aaccctgccaggctgagccgcagagagctggagaactttgatgtctactcctag

DBGET integrated database retrieval system