KEGG   Mus musculus (mouse): 18109Help
Entry
18109             CDS       T01002                                 

Gene name
Mycn, N-myc, Nmyc, Nmyc-1, Nmyc1, bHLHe37, c-nmyc
Definition
(RefSeq) v-myc avian myelocytomatosis viral related oncogene, neuroblastoma derived
  KO
K09109  N-myc proto-oncogene protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18109 (Mycn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18109 (Mycn)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    18109 (Mycn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N HLH CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 18109
NCBI-ProteinID: NP_032735
MGI: 97357
Ensembl: ENSMUSG00000037169
Vega: OTTMUSG00000032640
UniProt: P03966 Q3UII1
Position
12 A1.1; 12 6.14 cM
AA seq 462 aa AA seqDB search
MPSCTASTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRAFPEHSPEPSNWATEMLLPEADLWGNPAEEDAFGLGGLGGLTPNPVILQDCMWSG
FSAREKLERAVNEKLQHGHGPPGVSSACSAPGVGASSPGGRALGGSSSASHTGATLPTDL
SHPAAECVDPAVVFPFPVNKRESASVPAAPTSAPATSAAVTSVSVPATAPVAAPARAGGR
PASSGEAKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNNKAVTTFTITVR
PKTSALGLGRAQPGELILKRCVPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSV
VPAKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVI
LKKATEYVHALQANEHQLLLEKEKLQARQQQLLKKIEHARTC
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctgcaccgcgtccaccatgccggggatgatctgcaagaacccagacctcgag
tttgactcactgcagccctgcttctacccggacgaagatgacttctacttcggcggtccc
gactcgaccccaccgggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ttgtcgcccagccgcgccttcccagagcacagcccggagccttcgaattgggctacggag
atgctgctgccggaggccgacctgtggggcaacccggccgaggaggatgcgttcggtctc
gggggcctgggtggcctcactcctaatccggtcatccttcaggactgcatgtggagcggc
ttctctgcccgcgagaagctagagcgcgcagtgaacgaaaaactacagcacggccacggg
cccccgggcgtcagctcagcctgctcggctcccggagtgggtgccagcagccccgggggc
cgtgcccttggtgggtcgtcgagtgctagccacaccggggccaccctgcctaccgacctc
tcccacccggctgccgaatgtgtggaccccgccgtggtcttccccttcccggtgaacaag
cgagagtcggcgtcggtgcccgctgcccccactagcgccccggcgaccagcgctgcggtc
actagtgtgtctgttccagctactgccccggtggctgctcctgctcgtgcaggcggccgt
cctgccagcagtggggaggccaaggccctcagcacctccggagaggataccttgagcgac
tcagatgatgaggatgacgaggaggaagatgaagaggaggaaatcgatgtggtcaccgta
gagaagagacgttcctcctctaacaacaaggcggtaaccactttcacgatcactgtgcgt
cccaagacctccgctctgggcctggggcgagcacagcctggcgagctgatcctcaagcgc
tgtgttcccatccatcagcagcacaactatgctgcaccctcaccctacgtggagagcgag
gacgcgcccccgcagaaaaagatcaagagcgaggcttctccacgccccctcaaaagtgtt
gttccagcaaaagcgaagagcctgagcccccgaaactcagactcggaggacagcgagcgc
cgccgcaaccacaacatcctggagcgtcaacgccggaacgacctgcgctccagcttcctg
acgctcagggaccatgtgcctgagctggtgaagaacgagaaggccgccaaggtggtcatc
ttgaaaaaggccaccgagtacgtgcacgccctacaggccaacgagcaccagctcctgctg
gaaaaggagaaactgcaggcgaggcagcagcagttgctaaagaagatcgaacacgctcgg
acttgctaa

DBGET integrated database retrieval system