KEGG   Mus musculus (mouse): 18126Help
Entry
18126             CDS       T01002                                 

Gene name
Nos2, MAC-NOS, NOS-II, Nos-2, Nos2a, i-NOS, iNOS
Definition
(RefSeq) nitric oxide synthase 2, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04146  Peroxisome
mmu04371  Apelin signaling pathway
mmu04926  Relaxin signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    18126 (Nos2)
   00330 Arginine and proline metabolism
    18126 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    18126 (Nos2)
   04066 HIF-1 signaling pathway
    18126 (Nos2)
   04020 Calcium signaling pathway
    18126 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    18126 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    18126 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18126 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    18126 (Nos2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    18126 (Nos2)
   05133 Pertussis
    18126 (Nos2)
   05152 Tuberculosis
    18126 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18126 (Nos2)
   05145 Toxoplasmosis
    18126 (Nos2)
   05140 Leishmaniasis
    18126 (Nos2)
   05142 Chagas disease (American trypanosomiasis)
    18126 (Nos2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     18126 (Nos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18126
NCBI-ProteinID: NP_035057
MGI: 97361
Ensembl: ENSMUSG00000020826
Vega: OTTMUSG00000000146
UniProt: P29477
Structure
PDB: 

Position
11 B5; 11 46.74 cM
AA seq 1144 aa AA seqDB search
MACPWKFLFKVKSYQSDLKEEKDINNNVKKTPCAVLSPTIQDDPKSHQNGSPQLLTGTAQ
NVPESLDKLHVTSTRPQYVRIKNWGSGEILHDTLHHKATSDFTCKSKSCLGSIMNPKSLT
RGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLDEL
IFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAITV
FPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYGRFDVLP
LVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFPA
CPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSF
QKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYVLS
PFYYYQIEPWKTHIWQNEKLRPRRREIRFRVLVKVVFFASMLMRKVMASRVRATVLFATE
TGKSEALARDLATLFSYAFNTKVVCMDQYKASTLEEEQLLLVVTSTFGNGDCPSNGQTLK
KSLFMLRELNHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDELSGQE
DAFRSWAVQTFRAACETFDVRSKHHIQIPKRFTSNATWEPQQYRLIQSPEPLDLNRALSS
IHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIFPGNQTALVQG
ILERVVDCPTPHQTVCLEVLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHKL
ARFATDETDRQRLEALCQPSEYNDWKFSNNPTFLEVLEEFPSLHVPAAFLLSQLPILKPR
YYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWIRNLKPQDPVPCFVRSVSG
FQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMSLVFGCRHPEEDHLYQ
EEMQEMVRKRVLFQVHTGYSRLPGKPKVYVQDILQKQLANEVLSVLHGEQGHLYICGDVR
MARDVATTLKKLVATKLNLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGAKKGSALEEPK
ATRL
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcccctggaagtttctcttcaaagtcaaatcctaccaaagtgacctgaaagag
gaaaaggacattaacaacaacgtgaagaaaaccccttgtgctgttctcagcccaacaata
caagatgaccctaagagtcaccaaaatggctccccgcagctcctcactgggacagcacag
aatgttccagaatccctggacaagctgcatgtgacatcgacccgtccacagtatgtgagg
atcaaaaactggggcagtggagagattttgcatgacactcttcaccacaaggccacatcg
gatttcacttgcaagtccaagtcttgcttggggtccatcatgaaccccaagagtttgacc
agaggacccagagacaagcctacccctctggaggagctcctgcctcatgccattgagttc
atcaaccagtattatggctcctttaaagaggcaaaaatagaggaacatctggccaggctg
gaagctgtaacaaaggaaatagaaacaacaggaacctaccagctcactctggatgagctc
atctttgccaccaagatggcctggaggaatgcccctcgctgcatcggcaggatccagtgg
tccaacctgcaggtctttgacgctcggaactgtagcacagcacaggaaatgtttcagcac
atctgcagacacatactttatgccaccaacaatggcaacatcaggtcggccatcactgtg
ttcccccagcggagtgacggcaaacatgacttcaggctctggaattcacagctcatccgg
tacgctggctaccagatgcccgatggcaccatcagaggggatgctgccaccttggagttc
acccagttgtgcatcgacctaggctggaagccccgctatggccgctttgatgtgctgcct
ctggtcttgcaagctgatggtcaagatccagaggtctttgaaatccctcctgatcttgtg
ttggaggtgaccatggagcatcccaagtacgagtggttccaggagctcgggttgaagtgg
tatgcactgcctgccgtggccaacatgctactggaggtgggtggcctcgaattcccagcc
tgccccttcaatggttggtacatgggcaccgagattggagttcgagacttctgtgacaca
cagcgctacaacatcctggaggaagtgggccgaaggatgggcctggagacccacacactg
gcctccctctggaaagaccgggctgtcacggagatcaatgtggctgtgctccatagtttc
cagaagcagaatgtgaccatcatggaccaccacacagcctcagagtccttcatgaagcac
atgcagaatgagtaccgggcccgtggaggctgcccggcagactggatttggctggtccct
ccagtgtctgggagcatcacccctgtgttccaccaggagatgttgaactatgtcctatct
ccattctactactaccagatcgagccctggaagacccacatctggcagaatgagaagctg
aggcccaggaggagagagatccgatttagagtcttggtgaaagtggtgttctttgcttcc
atgctaatgcgaaaggtcatggcttcacgggtcagagccacagtcctctttgctactgag
acagggaagtctgaagcactagccagggacctggccaccttgttcagctacgccttcaac
accaaggttgtctgcatggaccagtataaggcaagcaccttggaagaggagcaactactg
ctggtggtgacaagcacatttgggaatggagactgtcccagcaatgggcagactctgaag
aaatctctgttcatgcttagagaactcaaccacaccttcaggtatgctgtgtttggcctt
ggctccagcatgtaccctcagttctgcgcctttgctcatgacatcgaccagaagctgtcc
cacctgggagcctctcagcttgccccaacaggagaaggggacgaactcagtgggcaggag
gatgccttccgcagctgggctgtacaaaccttccgggcagcctgtgagacctttgatgtc
cgaagcaaacatcacattcagatcccgaaacgcttcacttccaatgcaacatgggagcca
cagcaatataggctcatccagagcccggagcctttagacctcaacagagccctcagcagc
atccatgcaaagaacgtgtttaccatgaggctgaaatcccagcagaatctgcagagtgaa
aagtccagccgcaccaccctcctcgttcagctcaccttcgagggcagccgagggcccagc
tacctgcctggggaacacctggggatcttcccaggcaaccagaccgccctggtgcaggga
atcttggagcgagttgtggattgtcctacaccacaccaaactgtgtgcctggaggttctg
gatgagagcggcagctactgggtcaaagacaagaggctgcccccctgctcactcagccaa
gccctcacctacttcctggacattacgacccctcccacccagctgcagctccacaagctg
gctcgctttgccacggacgagacggataggcagagattggaggccttgtgtcagccctca
gagtacaatgactggaagttcagcaacaaccccacgttcctggaggtgcttgaagagttc
ccttccttgcatgtgcccgctgccttcctgctgtcgcagctccctatcttgaagccccgc
tactactccatcagctcctcccaggaccacaccccctcggaggttcacctcactgtggcc
gtggtcacctaccgcacccgagatggtcagggtcccctgcaccatggtgtctgcagcact
tggatcaggaacctgaagccccaggacccagtgccctgctttgtgcgaagtgtcagtggc
ttccagctccctgaggacccctcccagccttgcatcctcattgggcctggtacgggcatt
gctcccttccgaagtttctggcagcagcggctccatgactcccagcacaaagggctcaaa
ggaggccgcatgagcttggtgtttgggtgccggcacccggaggaggaccacctctatcag
gaagaaatgcaggagatggtccgcaagagagtgctgttccaggtgcacacaggctactcc
cggctgcccggcaaacccaaggtctacgttcaggacatcctgcaaaagcagctggccaat
gaggtactcagcgtgctccacggggagcagggccacctctacatttgcggagatgtgcgc
atggctcgggatgtggctaccacattgaagaagctggtggccaccaagctgaacttgagc
gaggagcaggtggaagactatttcttccagctcaagagccagaaacgttatcatgaagat
atcttcggtgcagtcttttcctatggggcaaaaaagggcagcgccttggaggagcccaaa
gccacgaggctctga

DBGET integrated database retrieval system