KEGG   Mus musculus (mouse): 18128Help
Entry
18128             CDS       T01002                                 

Gene name
Notch1, 9930111A19Rik, Mis6, N1, Tan1, lin-12
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu05020  Prion diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Module
mmu_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18128 (Notch1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    18128 (Notch1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18128 (Notch1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    18128 (Notch1)
   05206 MicroRNAs in cancer
    18128 (Notch1)
  09162 Cancers: Specific types
   05224 Breast cancer
    18128 (Notch1)
  09164 Neurodegenerative diseases
   05020 Prion diseases
    18128 (Notch1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    18128 (Notch1)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    18128 (Notch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank_2 DUF3454 Ank NOD NODP Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 18128
NCBI-ProteinID: NP_032740
MGI: 97363
Ensembl: ENSMUSG00000026923
Vega: OTTMUSG00000012795
UniProt: Q01705
Structure
PDB: 

Position
2 A3; 2 18.91 cM
AA seq 2531 aa AA seqDB search
MPRLLTPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDS
NPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQ
YHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSEPVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPL
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQLQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTTMP
SQITHIPEAFK
NT seq 7596 nt NT seq  +upstreamnt  +downstreamnt
atgccacggctcctgacgcccttgctctgcctaacgctgctgcccgcgctcgccgcaaga
ggcttgagatgctcccagccaagtgggacctgcctgaatggagggaggtgcgaagtggcc
aacggcactgaagcctgtgtctgcagcggagcctttgtgggccaacgatgccaggactcc
aatccttgcctcagcacaccgtgtaagaatgctggaacgtgccacgttgtggaccatggt
ggcactgtggattatgcctgcagctgtcccctgggtttctctgggcccctctgcctgaca
cctctggacaacgcctgcctggccaacccctgccgcaatgggggcacctgtgacctgctc
actctcacagagtacaagtgccgctgcccaccagggtggtcaggaaaatcatgtcagcag
gctgacccctgtgcctccaacccctgtgccaatggtggccagtgcctgccctttgagtct
tcatacatctgtcgctgcccgcctggcttccatggccccacctgcaggcaagatgttaat
gagtgcagccagaaccctgggctgtgccgccatggaggcacctgccacaatgagatcggc
tcctatcgctgtgcctgccgtgccacccatactggtccccactgtgaactgccctatgtg
ccctgcagcccctcaccctgccagaatggaggcacctgccgtcctacaggggacaccacc
cacgagtgtgcctgcttgccaggttttgctggacagaactgtgaagaaaatgtggatgac
tgtccaggaaacaactgcaagaatgggggtgcctgtgtggacggcgtgaatacctacaat
tgccgctgcccaccggagtggacgggtcagtactgtacagaggatgtggacgaatgtcag
ctcatgcccaatgcctgccagaatggcggaacctgccacaacacacacggcggctacaac
tgtgtgtgtgtcaatgggtggactggcgaggactgcagtgagaacattgatgactgtgcc
agtgccgcctgtttccagggtgccacttgccacgaccgtgtggcttccttctactgcgaa
tgtccgcatgggcgcacaggtctgctgtgccacctcaacgatgcgtgcatcagcaacccc
tgcaacgagggctccaactgtgacaccaaccctgtcaacggcaaagccatctgcacctgc
ccctcggggtacacagggccagcctgcagccaggacgtggatgagtgtgctctgggtgcc
aacccttgtgagcacgcaggcaaatgcctcaacacactgggttcttttgagtgccagtgt
ctacagggctacacgggaccccgctgtgagattgatgttaatgagtgcatctccaaccca
tgtcagaatgatgccacttgcctggaccagattggggagttccaatgcatatgtatgcca
ggttatgaaggtgtatactgtgaaatcaacacggatgagtgcgccagcagcccctgtctg
cacaatggccactgcatggacaagatcaatgagttccaatgtcagtgccccaaaggcttc
aacgggcacctgtgccagtatgatgtggatgagtgtgccagcacaccatgcaagaacggt
gccaagtgcctggatgggcccaacacctatacctgcgtgtgtacagaaggttacacaggg
acccactgcgaagtggacattgacgagtgtgaccctgacccctgccactatggttcctgt
aaggatggtgtggccacctttacctgcctgtgccagccaggctacacaggccatcactgt
gagaccaacatcaatgagtgccacagccaaccgtgccgccatgggggcacctgccaggac
cgtgacaactcctacctctgcttatgcctcaagggaaccacagggcccaactgtgagatc
aacctggatgactgcgccagcaacccctgtgactctggcacctgtctggacaagattgat
ggctacgaatgtgcctgtgaaccaggctacacaggaagcatgtgtaacgtcaacattgac
gaatgtgcgggcagcccctgccacaacgggggcacttgtgaggatggcatcgcgggcttc
acttgccgctgccccgagggctaccatgaccccacgtgcctgtccgaggtcaacgagtgc
aacagtaacccctgcatccacggagcttgccgggatggcctcaatgggtacaagtgtgac
tgtgcccctgggtggagtggaacaaactgtgacatcaacaacaacgagtgtgagtccaac
ccttgtgtcaacggtggcacctgcaaggacatgaccagtggctacgtatgcacctgccga
gaaggcttcagtggccctaattgccagaccaacatcaacgaatgtgcctccaacccctgc
ctgaaccaggggacctgcattgatgatgtcgctggatacaagtgcaactgtcctctgcca
tatacaggagccacgtgtgaggtggtgttggccccatgtgctaccagcccctgcaaaaac
agcggggtatgcaaggagtctgaagactatgagagtttttcctgtgtctgtcccacaggc
tggcaaggtcaaacctgcgaggttgacatcaatgagtgtgtgaaaagcccatgtcgccat
ggggcctcctgccagaacaccaatggcagctaccgctgcctctgccaggccggctataca
ggtcgcaactgtgagagtgacatcgatgactgccgccccaacccgtgtcacaatgggggt
tcctgcaccgatggcatcaacacagccttctgcgactgcctgcccggcttccagggtgcc
ttctgtgaggaggacatcaatgaatgtgccagcaatccctgccaaaatggtgccaattgc
actgactgtgtggacagctacacatgtacctgccccgtgggcttcaatggcatccactgc
gagaacaacacacctgactgtactgagagctcctgcttcaatggtggtacctgtgtggat
ggtatcaactccttcacctgtctgtgtccacctggcttcacgggcagctactgtcagtat
gatgtcaatgagtgtgattcacggccctgtctgcacggtggtacctgccaagacagctat
ggtacttataagtgtacctgcccacagggctacactggtctcaactgccagaaccttgtg
cgctggtgcgactcggctccctgcaagaatggtggcaggtgctggcagaccaacacgcag
taccactgtgagtgccgcagcggctggactggcgtcaactgcgacgtgctcagtgtgtcc
tgtgaggtggctgcacagaagcgaggcattgacgtcactctcctgtgccagcatggaggg
ctctgtgtggatgagggagataaacattactgccactgccaggcaggctacacgggcagc
tactgtgaggacgaggtggacgagtgctcacctaacccctgccagaatggagctacctgc
actgactatctcggcggcttttcctgcaagtgtgtggctggctaccatgggtctaactgc
tccgaggagatcaacgagtgcctgtcccagccctgccagaatgggggtacctgcattgat
ctgaccaactcctacaagtgttcctgcccccgggggacacagggtgtacactgtgagatc
aatgttgatgactgccatcccccccttgaccctgcctcccgaagccccaagtgcttcaac
aatggcacctgtgtggaccaggtgggtggctatacctgcacctgcccaccaggcttcgtc
ggggagcggtgtgagggtgatgtcaatgaatgtctctccaacccctgtgacccacgtggc
acccagaactgtgtgcagcgtgttaatgacttccactgcgagtgccgggctggccacact
ggacgccgctgtgagtcagtcatcaatggctgcaggggcaaaccttgcaagaatgggggt
gtctgtgccgtggcctccaacaccgcccgtggattcatctgtaggtgccctgcgggcttc
gagggtgccacatgtgagaatgatgcccgcacttgtggcagcttacgctgcctcaacggt
ggtacatgcatctcgggcccacgtagtcccacctgcctatgcctgggatccttcaccggc
cctgagtgccagttcccagccagcagcccctgtgtgggtagcaacccctgctacaatcag
ggcacctgtgagcccacatccgagaaccctttctaccgctgtctatgccctgccaaattc
aacgggctactgtgccacatcctggactacagcttcacaggtggcgctgggcgcgacatt
cccccaccgcagattgaggaggcctgtgagctgcctgagtgccaggtggatgcaggcaat
aaggtctgcaacctgcagtgtaataatcacgcatgtggctgggatggtggcgactgctcc
ctcaacttcaatgacccctggaagaactgcacgcagtctctacagtgctggaagtatttt
agcgacggccactgtgacagccagtgcaactcggccggctgcctctttgatggcttcgac
tgccagctcaccgagggacagtgcaaccccctgtatgaccagtactgcaaggaccacttc
agtgatggccactgcgaccagggctgtaacagtgccgaatgtgagtgggatggcctagac
tgtgctgagcatgtacccgagcggctggcagccggcaccctggtgctggtggtgctgctt
ccacccgaccagctacggaacaactccttccactttctgcgggagctcagccacgtgctg
cacaccaacgtggtcttcaagcgtgatgcgcaaggccagcagatgatcttcccgtactat
ggccacgaggaagagctgcgcaagcacccaatcaagcgctctacagtgggttgggccacc
tcttcactgcttcctggtaccagtggtgggcgccagcgcagggagctggaccccatggac
atccgtggctccattgtctacctggagatcgacaaccggcaatgtgtgcagtcatcctcg
cagtgcttccagagtgccaccgatgtggctgccttcctaggtgctcttgcgtcacttggc
agcctcaatattccttacaagattgaggccgtgaagagtgagccggtggagcctccgctg
ccctcgcagctgcacctcatgtacgtggcagcggccgccttcgtgctcctgttctttgtg
ggctgtggggtgctgctgtcccgcaagcgccggcggcagcatggccagctctggttccct
gagggtttcaaagtgtcagaggccagcaagaagaagcggagagagcccctcggcgaggac
tcagtcggcctcaagcccctgaagaatgcctcagatggtgctctgatggacgacaatcag
aacgagtggggagacgaagacctggagaccaagaagttccggtttgaggagccagtagtt
ctccctgacctgagtgatcagactgaccacaggcagtggacccagcagcacctggacgct
gctgacctgcgcatgtctgccatggccccaacaccgcctcagggggaggtggatgctgac
tgcatggatgtcaatgttcgaggaccagatggcttcacacccctcatgattgcctcctgc
agtggagggggccttgagacaggcaacagtgaagaagaagaagatgcacctgctgtcatc
tctgacttcatctaccagggcgccagcttgcacaaccagacagaccgcaccggggagacc
gccttgcacttggctgcccgatactctcgttcagatgctgcaaagcgcttgctggaggcc
agtgcagatgccaacatccaggacaacatgggccgtactccgttacatgcagcagtttct
gcagatgctcagggtgtcttccagatcctgctccggaacagggccacagatctggatgcc
cgaatgcatgatggcacaactccactgatcctggctgcgcgcctggccgtggagggcatg
ctggaggacctcatcaactcacatgctgacgtcaatgccgtggatgacctaggcaagtcg
gctttgcattgggcggccgcggtgaacaatgtggatgctgctgttgtgctcctgaagaac
ggagccaacaaggacatgcagaacaacaaggaggagactcccctgttcctggccgcccgt
gagggcagctatgagactgccaaagtgttgctggaccactttgccaaccgggacatcacg
gatcacatggaccgattgccgcgggacatcgcacaggagcgtatgcaccacgatatcgtg
cggcttttggatgagtacaacctggtgcgcagcccacagctgcatggcactgccctgggt
ggcacacccactctgtctcccacactctgctcgcccaatggctacctgggcaatctcaag
tctgccacacagggcaagaaggcccgcaagcccagcaccaaagggctggcttgtggtagc
aaggaagctaaggacctcaaggcacggaggaagaagtcccaggatggcaagggctgcctg
ttggacagctcgagcatgctgtcgcctgtggactccctcgagtcaccccatggctacttg
tcagatgtggcctcgccacccctcctcccctccccattccagcagtctccatccatgcct
ctcagccacctgcctggtatgcctgacactcacctgggcatcagccacttgaatgtggca
gccaagcctgagatggcagcactggctggaggtagccggttggcctttgagccacccccg
ccacgcctctcccacctgcctgtagcctccagtgccagcacagtgctgagtaccaatggc
acgggggctatgaatttcaccgtgggtgcaccggcaagcttgaatggccagtgtgagtgg
cttccccggctccagaatggcatggtgcccagccagtacaacccactacggccgggtgtg
acgccgggcacactgagcacacaggcagctggcctccagcatagcatgatggggccacta
cacagcagcctctccaccaataccttgtccccgattatttaccagggcctgcccaacaca
cggctggcaacacagcctcacctggtgcagacccagcaggtgcagccacagaacttacag
ctccagcctcagaacctgcagccaccatcacagccacacctcagtgtgagctcggcagcc
aatgggcacctgggccggagcttcttgagtggggagcccagtcaggcagatgtacaaccg
ctgggccccagcagtctgcctgtgcacaccattctgccccaggaaagccaggccctgccc
acatcactgccatcctccatggtcccacccatgaccactacccagttcctgacccctcct
tcccagcacagttactcctcctcccctgtggacaacacccccagccaccagctgcaggtg
ccagagcaccccttcctcaccccatcccctgagtcccctgaccagtggtccagctcctcc
ccgcattccaacatctctgattggtccgagggcatctccagcccgcccaccaccatgccg
tcccagatcacccacattccagaggcatttaaataa

DBGET integrated database retrieval system