KEGG   Mus musculus (mouse): 18131
Entry
18131             CDS       T01002                                 

Gene name
Notch3, AW229011, N3, hpbk
Definition
(RefSeq) notch 3
  KO
K20995  Notch 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04371  Apelin signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18131 (Notch3)
   04371 Apelin signaling pathway
    18131 (Notch3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    18131 (Notch3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18131 (Notch3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18131 (Notch3)
   05206 MicroRNAs in cancer
    18131 (Notch3)
  09162 Cancer: specific types
   05224 Breast cancer
    18131 (Notch3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18131 (Notch3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    18131 (Notch3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch EGF_2 Ank Ank_5 NODP NOD DUF3454 Ank_4 Ank_3 cEGF EGF_3
Other DBs
NCBI-GeneID: 18131
NCBI-ProteinID: NP_032742
MGI: 99460
Ensembl: ENSMUSG00000038146
Vega: OTTMUSG00000030086
UniProt: Q61982
Position
17 B1; 17 17.37 cM
AA seq 2318 aa
MGLGARGRRRRRRLMALPPPPPPMRALPLLLLLAGLGAAAPPCLDGSPCANGGRCTHQQP
SLEAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQ
PDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPG
SFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCV
CEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSL
CEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHR
GYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPCGPG
TCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHC
QYEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQTG
AYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTGS
HCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCID
LVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTG
LHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGG
QCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPGL
SGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAAP
EVPEEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDCSLNVDDPWRQCEALQCWRLFNN
SRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYH
RPSPGSESRVRRELGPEVIGSVVMLEIDNRLCLQSAENDHCFPDAQSAADYLGALSAVER
LDFPYPLRDVRGEPLEAPEQSVPLLPLLVAGAVFLLIIFILGVMVARRKREHSTLWFPEG
FALHKDIAAGHKGRREPVGQDALGMKNMAKGESLMGEVVTDLNDSECPEAKRLKVEEPGM
GAEEPEDCRQWTQHHLVAADIRVAPATALTPPQGDADADGVDVNVRGPDGFTPLMLASFC
GGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLL
DAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVE
GMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLA
AREGSYEAAKLLLDHLANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPHGL
GPLLCPPGAFLPGLKAVQSGTKKSRRPPGKTGLGPQGTRGRGKKLTLACPGPLADSSVTL
SPVDSLDSPRPFSGPPASPGGFPLEGPYATTATAVSLAQLGASRAGPLGRQPPGGCVLSF
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGAPVSPQERPPPYLAAPGHGEE
YPAAGTRSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATNAT
ASGALPAQPHPISVPSLPQSQTQLGPQPEVTPKRQVMA
NT seq 6957 nt   +upstreamnt  +downstreamnt
atggggctgggggcccggggccgccgccgccgtcgtcgcctgatggccttgccaccgcca
ccaccgcccatgcgggcgctgcccctgctgctgctgctagcggggctgggggctgcagca
cccccttgtctggatggaagcccatgtgcaaatggaggtcggtgcacccaccagcagccc
tccctggaggctgcttgcctgtgcctgccaggctgggtgggtgagcggtgccagctggaa
gacccttgccactcaggcccttgtgctggccgaggcgtttgccagagttcagtggtggcg
ggcaccgcccgattctcctgtcgttgtctccgtggcttccaaggcccagactgctcccag
ccagacccctgcgtcagcaggccctgtgttcatggtgccccctgctcagtggggccggat
ggccgatttgcctgtgcctgcccacctggctaccagggtcaaagctgccaaagtgacata
gatgagtgccgatctggtacaacttgccgtcatggtggtacctgtctcaatacacctgga
tccttccgctgccagtgtcctcttggttatacagggctgctgtgtgagaaccccgtagtg
ccctgtgccccttccccgtgtcgtaatggtggcacctgtaggcagagcagtgatgtcaca
tatgactgtgcttgccttcctggcttcgagggccagaactgtgaagtcaacgtggatgac
tgtcctggacatcggtgtctcaatgggggaacgtgtgtagacggtgtcaatacttacaac
tgccagtgccctccggagtggacaggccagttctgtacagaagatgtggatgagtgtcag
ctgcagcccaatgcctgccacaatgggggtacctgcttcaacctactgggtggccacagc
tgtgtatgtgtcaatggctggacgggtgagagctgcagtcagaatatcgatgactgtgct
acagccgtgtgtttccatggggccacctgccatgaccgtgtggcctctttctactgtgcc
tgccctatggggaagacaggcctcttgtgtcatctggatgatgcatgtgtcagcaacccc
tgccatgaggatgctatctgtgacacaaaccctgtgagtggccgggccatctgcacctgc
ccacctggcttcactggaggggcatgtgaccaggatgtggatgagtgctcgattggtgcc
aacccctgtgaacatttgggtcggtgtgtgaatacacagggctcattcttgtgccaatgt
ggccgtggctatactggacctcgctgtgagactgatgtcaatgagtgtctctccgggccc
tgccgcaaccaggccacgtgtcttgaccgaattggccagtttacttgcatctgcatggca
ggcttcacagggacctactgtgaggtggacatcgacgaatgtcagagcagcccatgtgtc
aatggtggtgtctgcaaggacagagtcaatggcttcagctgcacctgcccatcaggattc
agtgggtccatgtgtcagctggatgtggatgagtgtgcaagcactccctgccggaatggt
gccaagtgtgtggaccagcctgacggctatgagtgtcgctgtgcagagggctttgagggc
actttgtgtgagcgaaacgtggatgactgctctccggatccctgccaccacgggcgctgt
gtcgatggcattgctagcttctcgtgtgcttgtgccccaggctatacgggcatacgctgt
gagagccaggtggatgagtgccgcagccagccctgtcgatatgggggcaaatgtctagac
ttggtggacaagtacctctgccgttgtcctcccggaaccacaggtgtgaactgtgaagtc
aacattgatgactgtgccagtaacccctgtacctttggagtttgccgtgatggcatcaac
cgttatgactgtgtctgtcagcctggattcacagggcccctctgcaacgtggagatcaat
gagtgtgcatccagcccatgtggagagggtggctcctgtgtggatggggaaaatggcttc
cactgcctctgtccacctggctccctgcctccactttgcctacctgcgaaccatccctgt
gcccacaagccctgtagtcatggagtctgccatgatgcaccaggcgggttccgctgtgtt
tgtgagcccgggtggagtggccctcgctgtagccagagcctggctccagatgcctgtgag
tcccagccctgccaggctggtggcacctgcaccagtgatggaataggctttcgctgcacc
tgtgcccctggattccagggccatcagtgtgaggtgctgtccccctgtactccaagcctc
tgtgagcacggaggccactgtgagtctgaccctgaccggctgactgtctgttcctgtccc
ccaggctggcaaggcccacgatgccagcaggatgtggatgaatgtgccggtgcctcaccc
tgcggcccccatggtacctgcaccaacctgccagggaatttcaggtgcatctgccacagg
ggatacactggccccttctgtgatcaagacattgacgactgtgaccccaacccgtgcctc
catggtggctcctgccaggatggcgtgggctccttttcctgttcttgcctcgacggcttt
gctggtcctcgctgtgcccgagatgtggacgaatgtctgagcagcccctgtggccctggc
acctgtactgatcacgtggcctccttcacctgtgcctgtccacctggttatggaggcttc
cactgtgagattgacttgccggactgcagccccagttcctgcttcaatggagggacctgt
gtggatggcgtgagctccttcagctgtctgtgtcgccccggctacacaggcacacactgc
caatacgaggctgacccctgcttttcccggccctgtctgcacgggggcatctgcaacccc
acccacccaggatttgaatgcacctgccgggagggcttcactgggagtcagtgtcagaac
ccagtggactggtgcagccaggcaccctgtcagaatgggggtcgctgtgtccagactggg
gcttactgcatttgtccacctggatggagtggccgcctgtgcgacatacaaagcctgccc
tgcacggaggccgcagcccagatgggggtgaggttggagcagctgtgtcaggaaggtgga
aagtgcatagacaagggccgctcccactactgtgtgtgtccagagggccgtacgggtagt
cactgtgaacacgaggtggatccctgcacggcccagccttgccagcacgggggcacttgc
cgtggttacatggggggctatgtgtgtgagtgtccagctggctatgctggtgacagttgt
gaggataatatagatgagtgtgcttcccagccctgccagaacggaggctcctgtatcgat
cttgtggcccgctatctctgttcctgtccccctggcacactgggagttctctgtgagatc
aatgaggacgactgtgacctaggcccatccttggactcaggcgttcagtgcctacacaat
ggcacctgtgtggacctggtgggtggcttccgctgtaactgtcccccaggatacacaggt
ctgcactgtgaggcagacatcaatgagtgtcgcccgggtgcctgccatgcagcgcatact
cgggactgcctacaagatccaggtgggcatttccgctgcgtctgccatcctggcttcaca
gggcctcgctgtcagattgctctgtccccctgtgagtcccagccatgtcagcatggaggc
cagtgccgtcacagcctaggccgtggaggtgggctgaccttcacctgtcactgtgtcccg
ccattctggggtctgcgttgtgagcgggtggcacgctcttgccgagagctgcagtgccca
gtgggtatcccatgccagcagacagcccgtggaccacgctgcgcttgtcctccggggctg
tccgggccctcctgccgggtttctagggcgtcaccctcaggagctactaacgccagctgc
gcctctgccccttgtctgcatgggggctcatgcctacctgtacagagtgtccctttcttc
cgctgtgtgtgcgctccgggctggggcggcccgcgttgtgagaccccttccgcagcccct
gaggtccccgaggagccacggtgcccgcgagcggcttgccaggccaagcgaggggaccag
aactgcgatcgtgagtgcaacaccccaggctgtggctgggatggcggtgactgctcactg
aacgtggacgacccctggaggcagtgtgaggcactgcagtgctggcgtctcttcaacaac
agccggtgtgacccggcctgcagctctccagcctgcctctatgacaactttgactgctac
tctggtggccgcgaccgcacctgcaaccctgtttatgagaagtactgcgccgaccacttt
gcagatggccgttgtgaccagggctgcaacactgaggaatgcggctgggatgggctggac
tgtgccagcgaggtcccggcccttttggcccgaggggttctggtcctcacagttcttctg
cctcctgaagagttgctgcgctccagtgccgactttctgcagcgactcagcgctattctg
cgcacctcactgcgcttccgcttggacgcacgtggccaggccatggtcttcccctatcac
cggccaagccctggctctgaatcccgggtccgtcgtgagctgggtcctgaggtgatcggc
tctgtggtgatgctggagattgacaaccggctctgtctgcagtcagctgagaatgaccac
tgcttccctgatgcccagagtgctgctgactacctgggagccttgtcagcagtggagcga
cttgatttcccatacccacttcgggatgtgcgaggagagccgctggaggccccagagcag
agcgtgccactgctgccactgctggtggcaggggctgtctttctactcatcatcttcatc
ctgggtgtcatggttgccaggcgaaagcgagaacacagcaccctctggttccctgagggt
tttgcattacacaaggacatagctgctggccacaagggccggagggagcctgtgggacaa
gatgcactgggaatgaagaacatggccaagggtgagagtctgatgggggaggtggtcaca
gacttgaatgactcagaatgtccagaggccaagagactgaaggtagaggagccgggcatg
ggtgcagaggagcctgaggactgtcgccagtggacccaacaccacctggttgctgctgat
atccgtgtggcaccagccacagcgctgactcctcctcagggagatgcagatgcagacgga
gtggatgtcaacgtccgagggcctgatggcttcaccccacttatgctggcctccttctgt
gggggagccctggagccgatgccagctgaggaggatgaggcggatgacacatcagccagc
attatctcagatctgatctgtcaaggggcccagctcggggcacggactgaccgcactggc
gagaccgccctgcatttggctgcccgctatgctagagcggatgcagccaagcgtctcctg
gatgctggggcggacaccaacgcccaggatcattcgggccgcacccccctgcacaccgca
gtgacagctgatgcccagggtgtcttccagattctcatcaggaaccgctccactgacctg
gatgcccgaatggcagatggctctactgcactgatcctggcagcccgcctggcagtggag
ggcatggtggaagagctcatcgccagccatgccgatgtcaatgcagtggatgagcttggg
aaatctgccttacactgggctgcagctgtgaacaacgtggaggctaccttggctctgctg
aaaaatggagccaacaaggacatgcaggacagcaaggaagagacgccgctgttcttggcc
gctcgggagggcagctatgaggctgccaagctgctgctggatcatctcgccaaccgggag
atcacagatcacttggacaggctgccccgggacgtggcccaggagcggctgcaccaggac
attgtgcggttgctggaccagcccagtggacctcgaagtccctctggtccccatggctta
gggccattgctctgcccaccaggggccttccttcctggcctcaaagcggtgcagtctggg
accaagaagagcaggaggccacctggcaagaccgggctggggccacagggaactcgtggt
cggggcaagaagctgacactagcctgtccaggacctctggcagacagctctgtcacactg
tcaccggtggactctctggactcaccacggcctttcagtgggccccctgcttcccctgga
ggcttccccttggagggcccctatgccaccacggccaccgcggtgtccttggcacagcta
ggcgcaagtagggcgggtcctctggggcgccagcctcctgggggctgtgtgctcagcttt
ggtctgctcaatcctgtagctgttcccctcgactgggccaggctgcctccacctgcccct
ccagggccctcattcctgctgcccctggctccgggaccccagttgctcaacccaggagcc
ccagtttctccccaagagcggcccccaccctacctggctgctccaggacatggagaggaa
tatcctgcagcaggaacccgcagtagccccaccaaggcccgcttcctgcgggttcccagc
gagcatccttatttgaccccgtctcctgagtccccagagcactgggccagcccatccccc
ccatccctctcagactggtctgactcaacacctagcccagcaactgctaccaatgccaca
gcctctggagccctgcctgctcagccacaccccatatctgttccctccctccctcagtcc
cagactcagctgggaccccaaccagaagttacccccaagaggcaggtgatggcctaa

DBGET integrated database retrieval system