KEGG   Mus musculus (mouse): 18132
Entry
18132             CDS       T01002                                 

Gene name
Notch4, In, Int, Int-3, Int3, N, N4
Definition
(RefSeq) notch 4
  KO
K20996  Notch 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18132 (Notch4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18132 (Notch4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18132 (Notch4)
   05206 MicroRNAs in cancer
    18132 (Notch4)
  09162 Cancer: specific types
   05224 Breast cancer
    18132 (Notch4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18132 (Notch4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    18132 (Notch4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_5 Ank Ank_2 Notch Ank_3 Ank_4 EGF_2 NODP NOD EGF_3 EGF_MSP1_1 cEGF
Other DBs
NCBI-GeneID: 18132
NCBI-ProteinID: NP_035059
MGI: 107471
Ensembl: ENSMUSG00000015468
Vega: OTTMUSG00000020242
UniProt: P31695
Position
17 B1; 17 18.15 cM
AA seq 1964 aa
MQPQLLLLLLLPLNFPVILTRELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLGETCQ
FPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCP
PSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCP
PGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSC
LNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCP
KTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPG
YSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGF
TGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGAS
CLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAED
NCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG
LTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCV
NKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQT
LIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNG
GLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQCAPGYEGQN
CSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACH
SLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTC
SHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNG
TCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCS
LGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFH
NGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLR
VGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVV
MGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPSANQ
LPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPL
GEDNIGLKALKPEAEVDEDGVAMCSGPEEGEAEETASASRCQLWPLNSGCGELPQAAMLT
PPQECESEVLDVDTCGPDGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGAC
PQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQL
LLASRQTTVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVN
NARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPGD
VARQRSHWDLLTLLEGAGPTTQEARAHARTTPGGGAAPRCRTLSAGARPRGGGACLQART
WSVDLGARGGKVYARCRSRSGSCGGPTTRGRRFSAGSRGRRGARASQDDWPRDWVALEAC
GSACSAPIPPPSLTPSPERGSPQVAWGLPVHQEIPLNSVVRNLN
NT seq 5895 nt   +upstreamnt  +downstreamnt
atgcagccccagttgctgctgctgctgctcttgccactcaatttccctgtcatcctgacc
agagagcttctgtgtggaggatccccagagccctgtgccaacggaggcacctgcctgagg
ctatctcggggacaagggatctgccagtgtgcccctggatttctgggtgagacttgccag
tttcctgacccctgcagggatacccaactctgcaagaatggtggcagctgccaagccctg
ctccccacacccccaagctcccgtagtcctacttctccactgacccctcacttctcctgc
acctgcccctctggcttcaccggtgatcgatgccaaacccatctggaagagctctgtcca
ccttctttctgttccaacgggggtcactgctatgttcaggcctcaggccgcccacagtgc
tcctgcgagcctgggtggacaggtgagcaatgccagctccgagacttctgctcagccaac
ccctgtgccaacggaggcgtgtgcctggccacatacccccagatccagtgccgctgtcca
cctgggttcgagggtcacacctgtgaacgcgacatcaacgagtgcttcctggagccggga
ccctgccctcagggcacctcctgccataacaccttgggttcctaccagtgtctctgccct
gtggggcaggaaggtccccagtgcaagctcaggaagggagcctgccctcctggaagctgt
ctcaatgggggcacctgccagctggtcccagagggacactccacctttcatctctgcctc
tgtcccccaggtttcacggggctggactgtgagatgaacccagatgactgtgtcaggcac
cagtgtcagaacggggccacctgtctggatgggctggacacctacacctgcctctgcccc
aagacatggaagggctgggactgctctgaagatatagatgaatgtgaagcccggggtccc
cctcgctgcaggaacggtggcacctgccagaacacagctggcagctttcactgtgtgtgc
gtgagtggctggggaggcgcaggctgtgaggagaacctggatgactgtgcagctgccacc
tgtgccccgggatccacctgcatcgaccgtgtgggctccttctcctgcctctgcccacct
ggacgcacaggcctcctgtgccacctggaagacatgtgtttgagtcagccgtgccacgtg
aatgcccagtgcagcaccaaccctctgacaggctccaccctctgcatatgccagcctggc
tactcaggatccacctgtcaccaagatctggatgagtgccaaatggcccagcaaggaccc
agtccctgcgaacatggcggctcctgcatcaacacccctggctccttcaactgcctctgc
ctgcctggttacacgggctcccgctgtgaagctgaccacaatgagtgcctgtcacagccc
tgccacccaggcagcacctgcctggacctgcttgcaaccttccactgcctctgcccacca
ggcttggaagggaggctctgtgaggtggaggtcaatgagtgcacctctaatccctgcctg
aaccaagctgcctgccatgacctgctcaacggcttccagtgcctctgccttcctggattc
accggcgcccgatgtgagaaagacatggacgagtgtagcagcaccccctgtgccaatggg
gggcgctgccgagaccagcctggagccttctactgcgagtgtctcccaggctttgaaggg
ccacactgtgagaaagaagtggacgaatgtctgagtgacccctgccccgtgggagccagc
tgccttgatctccccggagcattcttctgcctctgccgtcctggtttcacaggtcaactt
tgtgaggttcccttgtgcacccccaacatgtgccaacctggacagcaatgccaaggtcag
gaacacagagccccctgcctctgccctgacggaagtcctggctgtgttcctgccgaggac
aactgcccctgtcaccatggccattgccagagatccttgtgtgtgtgtgatgagggctgg
actggaccagaatgcgagacagaactgggtggctgcatctccacaccctgtgcccatggg
gggacctgccacccacagccatctggctacaactgtacctgccctgcaggctacatgggg
ttgacctgtagtgaggaggtgacagcttgtcactcagggccctgtctcaatggtggctcc
tgcagcatccgtcctgagggctattcctgcacctgccttccaagtcacacaggtcgccac
tgccagactgccgtggaccactgtgtgtctgcctcgtgcctcaatgggggtacctgtgtg
aacaagcctggcactttcttctgcctctgtgccactggcttccaggggctgcactgtgag
gagaagactaaccccagctgtgcagacagcccctgcaggaacaaggcaacctgccaagac
acacctcgaggggcccgctgcctctgcagccctggctatacaggaagcagctgccagact
ctgatagacttgtgtgcccggaagccctgtccacacactgctcgatgcctccagagtggg
ccctcgttccagtgcctgtgcctccagggatggacaggggctctctgtgacttcccactg
tcctgccagaaggccgcgatgagccaaggcatagagatctctggcctgtgccagaatgga
ggcctctgtattgacacgggctcctcctatttctgccgctgccctcctggattccaaggc
aagttatgccaggataatgtgaacccctgtgagcccaatccctgccatcacgggtctacc
tgtgtgcctcagcccagtggctatgtctgccagtgtgccccaggctatgagggacagaac
tgctcaaaagtacttgacgcttgtcagtcccagccctgccacaaccacggaacctgtacc
tccaggcctggaggcttccactgtgcctgccctccaggcttcgtgggactgcgctgtgag
ggagatgtggatgagtgtctggaccggccctgtcacccctcgggcactgcagcttgccac
tctttagccaacgccttctactgccagtgtctgcctgggcacacaggccagcggtgtgag
gtggagatggacctctgtcagagccaaccctgctccaatggaggatcctgtgagatcaca
acagggccaccccctggcttcacctgtcactgccccaagggttttgaaggccccacctgc
agccacaaagccctttcctgcggcatccatcactgccacaatggaggcctatgtctgccc
tcccctaagccagggtcaccaccactctgtgcctgcctcagtggttttgggggccctgac
tgtctgacacctccagctccaccgggctgcggtcccccctcaccctgcctgcacaatggt
acctgcactgagacccctgggttgggcaacccgggctttcaatgcacctgccctcctgac
tctccagggccccggtgtcaaaggccaggggcaagtgggtgtgagggccgaggtggtgat
gggacctgcgatgctggctgcagtggcccaggaggagactgggatggaggggactgttcc
ctgggggtcccagacccctggaagggctgtcccccgcattcccagtgctggcttctgttc
cgggacggacggtgtcacccgcagtgtgactctgaggagtgtctctttgatggctacgac
tgtgaaatccctctaacctgcatcccagcctatgaccagtactgccgagatcacttccac
aacgggcactgtgagaaaggctgcaataacgctgaatgtggctgggacgggggagactgc
agaccagaaggggaagactcagaggggaggccctccctggccctgctggtggtgctgagg
cccccagccctggatcagcagctgcttgccctggcacgagtgctgtccctgactctgagg
gtcggtctctgggtgaggaaggacagtgaaggcaggaacatggtgttcccctatcctggg
acccgggccaaagaggagctgagtggagctagggattcctcttcatgggaaagacaagcc
cctcccactcagcccctgggcaaggagacagagtctcttggtgcagggtttgtggtagtg
atgggagtggatctgtcccgctgtggtccggaacatcctgcgtcccgctgcccctgggac
tctggactcctgctgcgcttccttgcagcaatggcagcagtgggagctctggagcccctg
ctgcctggacccttgctggcggctcaccctcaagcagggaccaggccctctgccaaccag
cttccctggcccattctatgttcaccagtggttggggtgcttctcctggcccttggggcc
cttctcgtcctccagctcattcggcgacggcgacgagaacatggggccctgtggctgccc
cctggtttcattcgaaggcctcagacacagcaggcaccccaccggcggaggcccccactg
ggcgaggacaacattggtcttaaggcactgaagccagaggccgaagtggatgaggatgga
gtggccatgtgctcgggccctgaagagggagaggctgaagaaacagcctcagcctccagg
tgccagctttggccgctcaacagcggctgtggagagctcccccaggcagccatgctgacc
cctcctcaggagtgtgaatcggaggttctggatgtggacacctgtggacctgatggggtg
acacccctgatgtcagccgtcttctgtgggggagtgcagtccacgactggggctagtcca
cagagactggggctaggaaatctggaaccctgggaaccactgctggatagaggggcctgc
ccccaggctcacactgtgggcactggagagacgcctctgcacctagctgccagattctct
cggccaaccgctgcccgccgcctccttgaggctggagccaaccccaaccagccagaccgc
gctgggcgcaccccacttcacactgctgtggctgccgacgctcgggaggtttgccagctc
ctattggccagcagacagactacggtggacgcccgcacagaggacgggactacacctttg
atgctggctgccaggctggccgtggaggacctggttgaagaattgatcgcagcccgagca
gatgtaggagccagggataaaaggggaaaaactgcactgcactgggccgctgctgtgaac
aacgcccgagccgcccgctctctcctccaggctggagcggataaagatgcccaggacagt
agggaacagacgccgcttttcctggcagcgcgcgaaggagccgtggaggtggcgcagctg
ttgctggagctcggggcggcccggggactgcgagaccaggccgggctggccccaggagat
gtggcccgccagcgcagtcactgggacctgctaacgctgctggaaggggctggaccgact
acgcaggaggcccgtgcgcacgcacgcaccacgccggggggcggggccgcgccgcgctgc
cggacgctgtctgcgggagcgcgcccgcgcgggggcggagcctgtctgcaggctcgcact
tggtcggtggacttgggagcgcgcggagggaaggtgtatgctcgctgccggagccgatct
ggaagctgcggaggccccaccacgcgcggccgcaggttctccgcgggctcccgtggacga
cgcggggctagggcatcacaggatgactggcctcgcgactgggtggccctggaagcctgc
ggctccgcctgcagtgcgccgatcccgcctcccagcctgaccccgtccccagaacgtgga
tcccctcaagttgcctggggtcttccagttcaccaagagattcccttaaactcggttgta
agaaatctgaactag

DBGET integrated database retrieval system