KEGG   Mus musculus (mouse): 18141
Entry
18141             CDS       T01002                                 

Symbol
Nup50, 1700030K07Rik, AI413123, Npap60
Name
(RefSeq) nucleoporin 50
  KO
K14295  nuclear pore complex protein Nup50
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    18141 (Nup50)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    18141 (Nup50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18141 (Nup50)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     18141 (Nup50)
SSDB
Motif
Pfam: NUP50 Ran_BP1
Other DBs
NCBI-GeneID: 18141
NCBI-ProteinID: NP_057923
MGI: 1351502
Ensembl: ENSMUSG00000016619
UniProt: Q9JIH2
Structure
Position
15:84800100..84827164
AA seq 466 aa
MAKRVAEKELTDRNWDEEDEVEEMGTFSVASEEVMKNRAVKKAKRRNVGFESDSGGAFKG
FKGLVVPSGGGGFSGFGGSGGKPLEGLTNGNSTDNATPFSNVKTAAEPKAAFGSFAVNGP
TTLVDKKISSPKCNNSNQPPSSGPASSTACPGNAYHKQLAGLNCSVRDWIVKHVNTNPLC
DLTPIFKDYERYLATIEKQLENGGGSSSESQTDRATAGMEPPSLFGSTKLQQESPFSFHG
NKAEDTSEKVEFTAEKKSDAAQGATSASFSFGKKIESSALGSLSSGSLTGFSFSAGSSSL
FGKDAAQSKAASSLFSAKASESPAGGGSSECRDGEEEENDEPPKVVVTEVKEEDAFYSKK
CKLFYKKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLGNILLNVLIAPNMPCTRTGKN
NVLIVCVPNPPLDEKQPTLPATMLIRVKTSEDADELHKILLEKKDA
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggcgaagagagttgcggagaaggagttgactgacaggaactgggatgaggaagacgaa
gttgaagagatgggaacattctcagtggccagtgaggaagtcatgaagaacagagccgta
aagaaggcaaagcgcagaaacgttggatttgaatctgatagcggaggagcctttaaaggt
ttcaaaggtttggttgtgccttctggaggaggagggttttctggatttggtggctctgga
ggaaagcctctggaaggactgacaaatggaaacagcacagacaatgccacgcccttctcc
aatgtaaagacagcagcagagcccaaggcagcctttggttcttttgctgtgaatggccct
actaccttggtggataaaaagatttcaagtcccaaatgcaataacagcaatcagccgccc
tcctccggccctgcttccagtaccgcctgccctgggaatgcctatcacaagcagctggct
ggcttgaactgctccgtccgcgattggatagtgaagcacgtgaacacaaacccgctttgt
gacctgactcccatttttaaagactatgagagatacttggcgacgatcgagaagcagctt
gagaatggaggcggcagcagttctgagagccagacagacagggcgacggctggaatggag
cctccttccctttttggttcaacaaaactacagcaagagtcaccattttcatttcatggc
aacaaagcggaggacacatctgaaaaggtggagtttacagcagaaaagaaatcggacgca
gcacaaggagcaacaagtgcctcgtttagtttcggcaagaaaattgagagctcggctttg
ggctcgttaagctctggctccctaactgggttttcattctctgctggaagctccagcttg
tttggtaaagatgctgcccagagtaaagcagcctcttcgctgttctctgctaaagcatcc
gagagtccggcaggaggcggcagcagcgagtgcagagatggtgaagaagaggagaatgac
gagccacccaaggtagtggtgaccgaagtaaaggaagaggatgctttctactccaaaaaa
tgtaaactattttacaagaaagacaacgaatttaaagagaagggtgtggggaccctgcat
ttaaaacccacagcaactcagaagacccagctcttggtgcgggcagacaccaacctaggc
aacatactgctgaatgttctgatcgcccccaacatgccgtgcacccggacaggaaagaac
aacgtccttatcgtctgtgtccccaaccccccactcgatgagaagcagcccactctcccg
gccaccatgctgatccgggtgaagacgagcgaggatgccgatgaattgcacaagatttta
ctggagaaaaaggatgcctga

DBGET integrated database retrieval system