KEGG   Mus musculus (house mouse): 18146
Entry
18146             CDS       T01002                                 
Symbol
Npdc1, AI314472, NPDC-1
Name
(RefSeq) neural proliferation, differentiation and control 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NPDC1
Other DBs
NCBI-GeneID: 18146
NCBI-ProteinID: NP_032747
MGI: 1099802
Ensembl: ENSMUSG00000015094
UniProt: Q64322
Position
2:25293062..25299506
AA seq 332 aa
MATPVPPPSPRHLRLLRLLLSGLILGAALNGATARRPDATTCPGSLDCALKRRAKCPPGA
HACGPCLQSFQEDQRGFCVPRKHLSSGEGLPQPRLEEEIDSLAQELALKEKEAGHSRLTA
QPLLEAAQKLLEPAATLGFSQWGQRLEPGLPSTHGTSSPIPHTSLSSRASSGPVQMSPLE
PQGRHGNGLTLVLILAFCLASSAALAVAALCWCRLQREIRLTQKADYAATAKGPTSPSTP
RISPGDQRLAHSAEMYHYQHQRQQMLCLERHKEPPKELESASSDEENEDGDFTVYECPGL
APTGEMEVRNPLFDHSTLSAPVPGPHSLPPLQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcgacgcccgtccctccgccttccccgcggcacctgcggctgctacggctgctgctc
tccggcctcatcctgggagcggccctgaatggtgccaccgcccgccgcccggatgctacc
acctgtcctggaagcctggattgtgcactgaagaggcgggcaaaatgcccaccaggggca
catgcctgtggaccatgccttcagtccttccaggaagaccagcgagggttctgtgtgcca
aggaaacacctatcttctggggagggcctgccccagcccagactggaagaggagatcgat
tctctggcccaggaactggcactgaaggagaaggaggcggggcactcaaggctgaccgca
cagcccttgcttgaggctgcgcagaagctcctggagcctgcagctaccctgggattctca
cagtggggtcaacgactggagcccgggctcccctctactcatggaacctcttcacctata
ccccatacttccttgagttcccgagcatcctctggacctgtgcagatgtccccgctggag
ccccagggaaggcatgggaatggcctcacccttgtgctgatcctggctttctgcttagca
agctcagccgccctggctgtggcagccctctgctggtgtaggcttcagcgagagatccgc
ctgactcagaaggctgactatgctgccacagctaaggggcccacttcaccttcaacacca
cgaatctcgcctggggatcagcggctggcacacagtgctgagatgtatcattatcagcac
cagagacagcagatgctgtgcctggagcggcataaggaacctccaaaggaactagagtca
gcttcctccgatgaggaaaatgaagatggcgacttcactgtgtatgaatgcccaggcctg
gcgccaacaggggagatggaggtgcgcaacccactgtttgaccattccacgctgtcagca
ccagtgcctggtccccattccttgccgccgctgcagtga

DBGET integrated database retrieval system