KEGG   Mus musculus (house mouse): 18155
Entry
18155             CDS       T01002                                 
Symbol
Pnoc, N/OFQ, Npnc1, OFQ/N
Name
(RefSeq) prepronociceptin
  KO
K25696  prepronociceptin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18155 (Pnoc)
SSDB
Motif
Pfam: Opiods_neuropep
Other DBs
NCBI-GeneID: 18155
NCBI-ProteinID: NP_035062
MGI: 105308
Ensembl: ENSMUSG00000045731
UniProt: Q64387 Q543U6
Position
14:complement(65638122..65663130)
AA seq 187 aa
MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTV
CTKVMASGSGQLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGA
DAEPGADDAEEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRT
LHQNGNV
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaaaatcctcttttgtgacgttctgctgctcagcctgctctccagcgtgttcagcagc
tgtcccagggactgcctcacctgccaggagaagctccacccagctccagacagcttcaac
ttaaagacgtgcatcctccagtgtgaagagaaggtcttcccccgccctctctggactgta
tgcaccaaagtcatggccagtggctccgggcagctcagccctgctgacccagagcttgtg
tcagctgctctttaccagccaaaggcctcggagatgcagcacctgaagagaatgccgcgt
gtccggagcttggtgcaagtgcgagatgcagagcctggcgcagatgctgagcctggcgca
gatgctgagcctggcgcagatgacgctgaggaggtggagcagaagcagctgcagaaaagg
tttgggggcttcaccggggcccggaaatcagcccggaagttggccaaccagaagcggttc
agtgagtttatgaggcagtacctggtcctgagcatgcagtcaagtcaacgccggcgcacc
ctgcaccagaatggtaatgtgtag

DBGET integrated database retrieval system