KEGG   Mus musculus (mouse): 18168Help
Entry
18168             CDS       T01002                                 

Gene name
Npy5r, NPY5-R, NPYY5-R, Y5R
Definition
(RefSeq) neuropeptide Y receptor Y5
  KO
K04207  neuropeptide Y receptor type 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    18168 (Npy5r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    18168 (Npy5r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 18168
NCBI-ProteinID: NP_057917
MGI: 108082
Ensembl: ENSMUSG00000044014
Vega: OTTMUSG00000061841
UniProt: O70342 Q543U8
Position
8 B3.1; 8 33.15 cM
AA seq 466 aa AA seqDB search
MEVKLEEHFNKTFVTENNTAASQNTASPAWEDYRGTENNTSAARNTAFPVWEDYRGSVDD
LQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTL
TSVLLDQWMFGKAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFL
IATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQ
YILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLHPSKKSRDQAKPPSTQKWSY
SFIRKHRRRYSKKTACVLPAPAGPSQEKHLTVPENPGSVRSQLSPSSKVIPGVPICFEVK
PEESSDAQEMRVKRSLTRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISN
RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIHCLHMS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaaacttgaagagcattttaacaagacatttgtcacggagaacaatactgct
gccagtcagaacacggcctcccctgcctgggaggactacagaggcacagagaacaatact
tctgctgctcggaacactgcctttccagtctgggaggactatagaggcagcgtagacgac
ttacaatacttcctgattgggctctatacatttgtaagtcttcttggttttatgggaaat
ctacttatcttaatggctgttatgaaaaagcgcaatcagaagactacagtgaactttctc
ataggcaacctggccttctccgacattttggttgtcctgttttgctcccctttcaccctg
acctctgtcttgttggatcagtggatgttcggcaaagccatgtgccatatcatgccattc
cttcagtgtgtatcagttctggtttcaactctgattttaatatcgattgccattgtcagg
tatcatatgataaagcaccctatatctaacaatttaacagcaaaccatggctacttcctg
atagctactgtctggacactgggctttgccatctgttctcccctcccagtgtttcacagc
cttgtggaacttaaggaaacctttggctcagcattgctaagcagcaagtatttgtgtgtt
gagtcatggccctctgattcatacagaattgctttcacaatctctttattgttagttcag
tatatcctgcctctagtatgtttaacagtaagtcatactagtgtctgcaggagtataagc
tgtggattgtcccacaaagaaaacagactcgaagaaaatgagatgatcaacttaactcta
catccatccaaaaagagtcgggaccaggcaaaaccccccagcactcaaaagtggagctac
tcattcatcagaaagcaccgaagaaggtacagcaagaagacggcatgcgtgttacccgcc
ccagcaggaccttcccaggagaagcacctaaccgttccagaaaacccaggctcggtccgt
agccagctgtcaccatccagtaaggttattccaggggtcccgatctgctttgaggtgaaa
cctgaagaaagctcagatgctcaggagatgagagtcaagcgttccctcacgagaataaag
aagagatctcgcagtgttttctacagactgactatattgatattagtgttcgctgttagc
tggatgccactccacgtcttccacgtggtgaccgatttcaatgataacctgatttccaat
aggcatttcaagctggtgtactgcatctgtcacttgttaggcatgatgtcctgttgtctt
aatccgatcttatatggattccttaataatggtatcaaagcagacttgagagcccttatc
cactgcctacacatgtcatga

DBGET integrated database retrieval system