KEGG   Mus musculus (mouse): 18181Help
Entry
18181             CDS       T01002                                 

Gene name
Nrf1, C87038, D6Ertd415e
Definition
(RefSeq) nuclear respiratory factor 1
  KO
K11831  nuclear respiratory factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04371  Apelin signaling pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    18181 (Nrf1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    18181 (Nrf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    18181 (Nrf1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    18181 (Nrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nrf1_DNA-bind Nrf1_activ_bdg DUF5008 DUF3459 Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 18181
NCBI-ProteinID: NP_001157698
MGI: 1332235
Ensembl: ENSMUSG00000058440
Vega: OTTMUSG00000014351
UniProt: Q9WU00 Q8C4C0
Position
6 A3.3; 6 12.47 cM
AA seq 503 aa AA seqDB search
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcacggagtgacccaaactgaacacatggctaccatagaagcccatgcagtg
gcccagcaagtccagcaggtccatgtagccacgtacactgagcacagtatgctaagtgct
gatgaagactccccttcctcccccgaggacacttcttatgatgactcggacatcctcaac
tccacggcagctgatgaggtaactgcccatctggctgctgcaggtcctgtgggaatggcc
gctgctgctgctgtggcaacagggaagaaacggaaacggcctcatgtgtttgagtctaat
ccatctatccgaaagagacagcagacacgtttgcttcggaaactcagagccacgttggat
gagtacacgacgcgagtgggacagcaagcgattgtactctgcatctcaccctccaaaccc
aaccctgtcttcaaggtgtttggcgcagcacctttggagaatgtggtgcgaaagtacaag
agcatgatcctggaagacctcgagtctgctctggcagaacacgcccctgcgccacaggag
gttaattcagagctgccgcctctcaccatcgatgggattccagtctctgtggacaaaatg
acccaggctcagcttcgggcatttatcccagagatgctcaagtattccacaggtcggggg
aaaccaggctgggggaaagaaagctgcaagcctatctggtggccagaagatatcccatgg
gccaatgtccgcagtgatgtccgcacagaagagcaaaaacaaagggtttcatggacccag
gcattacggaccatagttaaaaattgctataagcaacatgggcgggaggatcttttatat
gcttttgaagatcagcaaacacaaactcaggccaccaccacacacagtatagctcatctc
gtaccatcacagaccgtagtacagaccttcagcaaccctgatggcaccgtgtcgctcatc
caggttggtacaggggcaacagtagccacattggctgatgcttcagaactgccaaccaca
gtcactgttgcccaagtgaattactctgctgtggctgatggagaggtggaacaaaactgg
gccacgttacagggcggtgaaatgaccatccagacgacgcaagcatcagaggccacccag
gcggtagcatcactggcagaagccgcagtggcagcttctcaggagatgcagcagggagcc
actgtcaccatggccctcaacagtgaagctgccgcccatgctgtcgccactctggcggaa
gccaccttacaaggtgggggacagatagtcctgtctggggaaaccgcagcagccgtcgga
gcacttactggagtccaagatgctaatggcctggtccagatccctgtgagcatgtaccag
actgtggtaaccagcctcgcccagggcaacgggccggtgcaggtggccatggccccagtg
accaccaggatatcggacagcgcagtcaccatggatggccaggctgtggaggtggtgacc
ttggaacagtag

DBGET integrated database retrieval system