KEGG   Mus musculus (mouse): 18183
Entry
18183             CDS       T01002                                 

Gene name
Nrg3, s, ska
Definition
(RefSeq) neuregulin 3
  KO
K05457  neuregulin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    18183 (Nrg3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    18183 (Nrg3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18183 (Nrg3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18183 (Nrg3)
SSDB
Motif
Pfam: EGF DUF6479 Laminin_EGF LapA_dom DUF6377 EGF_2
Other DBs
NCBI-GeneID: 18183
NCBI-ProteinID: NP_032760
MGI: 1097165
Ensembl: ENSMUSG00000041014
Vega: OTTMUSG00000037129
UniProt: O35181
Position
14; 14 B
AA seq 713 aa
MSEGAAGASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPPTVLSTTAPFFSSSTPGSRPPMPGAPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAAAASSSSPSSTSSTTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYC
LNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEDVYQ
RQVLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEHLKESQNGKNYSLKASSTKSESLM
KSHVHLQNYSKADRHPVTALEKIMESSFSAPQSFPEVTSPDRGSQPIKHHSPGQRSGMLH
RNTFRRAPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPIQLWCVER
PLDLKYVSNGLRTQQNASINMQLPSRETNPYFNSLDQKDLVGYLSPRANSVPIIPSMGLE
ETCMQMPGISDVKSIKWCKNSYSADIVNASMPVSDCLLEEQQEVKILLETVQEQIRILTD
ARRSEDFELASMETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSVLTK
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccggtgcctcgccacctggtgccgcttcggcagccgccgcctca
gccgaggagggcaccgcggcggctgcggcggcggcggcggcgggcgggggcccggacggc
ggcggagaaggggcggccgaacctccccgggagttacgctgtagcgactgcatcgtgtgg
aaccggcagcagacgtggttgtgcgtggtgcctctgttcatcggcttcatcggcctgggg
ctcagcctcatgctgcttaaatggatcgtggtaggctccgtcaaggagtacgtgcccacg
gacctggtggactccaagggaatgggccaggaccccttcttcctctccaagcccagctct
ttccccaaggctatggaaaccaccacaacaaccacttctaccacgtcccccgccaccccc
tctgccggcggcgccgcttcttccaggacgcctaaccggattagcacccgcttgaccacc
atcacacgggcacccacccgcttccctgggcaccgggttcccatccgggctagcccgcgc
tctaccacagcacggaacactgctgcccctccgacggtcctgtccaccacggcccctttc
ttcagtagcagcacgcccggctcccgacccccgatgccaggagcccccagtacgcaggcg
atgccttcctggcccactgcggcgtatgctacctcctcctacctccacgattccactccc
tcctggaccctgtcaccctttcaggatgctgctgccgcctcttcctcctcaccctcttcc
acctcctccactaccaccaccccagaaactagcaccagccccaaatttcatactacaaca
tactccactgaacgatctgagcacttcaaaccctgtcgagacaaggacctggcgtattgt
ctcaatgatggtgaatgctttgtgattgagaccctgacaggatcccataagcactgtcgg
tgcaaggaaggctaccaaggagtccgttgtgatcaatttctgccgaaaacagactccatc
ttatcggatccaacagaccacttggggattgaattcatggagagtgaagacgtttatcaa
aggcaggtgctgtcaatttcatgtatcatctttggaattgtcatcgtgggcatgttctgt
gcagcattctacttcaaaagcaagaaacaagctaaacaaattcaggagcacctgaaagag
tcacagaatgggaagaactacagcctcaaggcatccagcacaaagtctgagagcttgatg
aagagccatgtccatctacaaaattattcaaaggcggataggcatcctgtgactgcgctg
gagaaaataatggagtcaagtttttcagctccccagtcgttcccagaagtcacttctcct
gaccgaggaagccagcctatcaagcaccacagcccaggacaaaggagtgggatgttgcat
aggaatactttcagaagggcaccaccctcaccccgaagtcgactgggtggtattgtagga
ccagcatatcaacaacttgaagaatcaagaattccagaccaggatacgataccttgccaa
gggatagaggtcaggaagactatatcccacctgcctatacagctgtggtgtgttgaaaga
cccctggacttaaagtatgtgtccaatggcttaagaacccaacaaaatgcatcaataaat
atgcaactgccttcaagagagacaaacccctattttaatagcttggatcaaaaggacctg
gtgggttatttatccccaagggccaattctgtgcccatcatcccgtcgatgggtctagaa
gaaacctgcatgcaaatgccagggatttctgacgtcaaaagcattaaatggtgcaaaaac
tcctactccgctgacattgtcaacgcgagtatgccagtcagtgattgtcttctagaagaa
caacaggaagtgaaaatattactagagactgtgcaggaacagatccggattctgactgat
gccagacggtcagaagacttcgaactggccagcatggaaactgaggacagtgcgagcgaa
aacacagcctttctccccctgagtcccacggccaaatcagaacgagaggcacaatttgtc
ttaagaaatgaaatacaaagagactctgtgctaaccaagtga

DBGET integrated database retrieval system