KEGG   Mus musculus (mouse): 18187
Entry
18187             CDS       T01002                                 

Gene name
Nrp2, 1110048P06Rik, Np-2, Np2, Npn-2, Npn2
Definition
(RefSeq) neuropilin 2
  KO
K06819  neuropilin 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18187 (Nrp2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    18187 (Nrp2)
SSDB
Motif
Pfam: CUB F5_F8_type_C DUF3481 MAM
Other DBs
NCBI-GeneID: 18187
NCBI-ProteinID: NP_001070871
MGI: 1100492
Ensembl: ENSMUSG00000025969
Vega: OTTMUSG00000002566
UniProt: O35375 Q3U5I8
Position
1; 1 C2
AA seq 931 aa
MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSKLRS
STGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPLGMESGRIANEQISASSTFS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQKGYYVKS
YKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLHMPLLTRFIRIRPQTWHLGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREYLWSPSAARLVSSRSGWFPRNPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPMDEDATECGENCSFEDDKDLQLPSGFNCNFDFPEETCGWVYD
HAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGRREGQYGRLISPPVHLPRSPVCMEFQY
QAMGGHGVALQVVREASQESKLLWVIREDQGSEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEISIDDIRISTDVPLENCMEPISAFAGEDFKVDIPETHGGEGYEDEIDDEYEGDWSNS
SSSTSGAGDPSSGKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKINHQKCCSEA
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggatatgtttcctcttacctgggttttcttagctctgtacttttcaggacacgaagtg
agaagccagcaagatccaccctgcggaggtcggctgaattccaaagatgctggctacatc
acttccccaggctacccccaggactatccctcccaccagaactgtgagtggattgtctac
gcccccgaacccaaccagaagattgttctcaacttcaaccctcactttgaaatcgagaaa
cacgactgcaagtatgacttcattgagattcgggatggggacagtgagtcagctgacctc
ctgggcaagcactgtgggaacatcgccccgcccaccatcatctcctcaggctccgtgtta
tacatcaagttcacctcagactacgcccggcagggggcaggtttctctctacgctatgag
atcttcaaaacaggctctgaagattgttccaagaactttacaagccccaatgggaccatt
gaatctccagggtttccagagaagtatccacacaatctggactgtaccttcaccatcctg
gccaaacccaggatggagatcatcctacagttcctgacctttgacctggagcatgaccct
ctacaagtgggggaaggagactgtaaatatgactggctggacatctgggatggcattcca
catgttggacctctgattggcaagtactgtgggacgaaaacaccctccaaactccgctcg
tccacggggatcctctccttgacctttcacacggacatggcagtggccaaggatggcttc
tccgcacgttactatttgatccaccaggagccacctgagaattttcagtgcaatgtccct
ttgggaatggagtctggccggattgctaatgaacagatcagtgcctcctccaccttctct
gatgggaggtggactcctcaacagagccggctccatggtgatgacaatggctggacaccc
aatttggattccaacaaggagtatctccaggtggacctgcgcttcctaaccatgctcaca
gccattgcaacacagggagccatttccagggaaacccagaaaggctactacgtcaaatcg
tacaagctggaagtcagcacaaatggtgaagattggatggtctaccggcatggcaaaaac
cacaagatattccaagcgaacaatgatgcgaccgaggtggtgctaaacaagctccacatg
ccactgctgactcggttcatcaggatccgcccgcagacgtggcatttgggcattgccctt
cgcctggagctctttggctgccgggtcacagatgcaccctgctccaacatgctggggatg
ctctcgggcctcattgctgatacccagatctctgcctcctccacccgagagtacctctgg
agccccagtgctgcccgcctggttagtagccgctctggctggtttcctcggaaccctcaa
gcccagccaggtgaagaatggcttcaggtagacctggggacacccaagacagtgaaaggg
gtcatcatccagggagcccgaggaggagacagcatcactgccgtggaagccagggcgttt
gtacgcaagttcaaagtctcctacagcctaaatggcaaggactgggaatatatccaggac
cccaggactcagcagacaaagctgtttgaagggaacatgcactatgacacccctgacatc
cgaaggttcgatcctgttccagcgcagtatgtgcgggtgtacccagagaggtggtcgcca
gcaggcatcgggatgaggctggaggtgctgggctgtgactggacagactcaaagcccaca
gtggagacgctgggacccaccgtgaagagtgaagagactaccaccccatatcccatggat
gaggatgccaccgagtgtggggaaaactgcagctttgaggatgacaaagatttgcaactt
ccttcaggattcaactgcaactttgattttccggaagagacctgtggttgggtgtacgac
catgccaagtggctccggagcacgtggatcagcagcgctaaccccaatgacagaacattt
ccagatgacaagaacttcttgaaactgcagagtgatggccgacgagagggccagtacggg
cggctcatcagcccaccggtgcacctgccccgaagccctgtgtgcatggagttccagtac
caagccatgggcggccacggggtggcactgcaggtggttcgggaagccagccaggaaagc
aaactcctttgggtcatccgtgaggaccagggcagcgagtggaagcacgggcgcattatc
ctgcccagctatgacatggagtatcagatcgtgttcgagggagtgatagggaagggacga
tcgggagagatttccatcgatgacattcggataagcactgatgtcccactggagaactgc
atggaacccatatcagcttttgcaggtgaggattttaaagtggacatcccagaaacccat
gggggagagggctatgaagatgagattgatgatgaatatgaaggagattggagcaactct
tcttcctctacctcaggggctggtgacccctcatctggcaaagaaaagagctggctgtac
accctagatcccattctgatcaccatcatcgccatgagctcgctgggggtcctgctgggg
gccacctgtgcgggcctcctcctttactgcacctgctcctattcgggtctgagttcgagg
agctgcaccacactggagaactacaactttgagctctacgatggcctcaagcacaaggtc
aagatcaatcatcagaagtgctgctcggaggcatga

DBGET integrated database retrieval system