KEGG   Mus musculus (mouse): 18198
Entry
18198             CDS       T01002                                 

Symbol
Musk, Mdk4, Mlk, Ns, Nsk1, Nsk2, Nsk3
Name
(RefSeq) muscle, skeletal, receptor tyrosine kinase
  KO
K05129  muscle, skeletal, receptor tyrosine kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18198 (Musk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18198 (Musk)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  MUSK family
   18198 (Musk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr I-set Ig_3 Pkinase Ig_2 ig Fz C2-set_2 V-set Ig_6 CD34_antigen Ig_4 Izumo-Ig
Other DBs
NCBI-GeneID: 18198
NCBI-ProteinID: NP_035074
MGI: 103581
Ensembl: ENSMUSG00000057280
Vega: OTTMUSG00000007438
UniProt: Q61006 Q497X0 Q32S50
Position
4 B3; 4 31.87 cM
AA seq 868 aa
MRELVNIPLLQMLTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCIANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVTLRCTAIGIPV
PTISWIENGNAVSSGSIQESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
VSIAEWSKSQKDSQGYCAQYRGEVCDAVLAKDALVFFNTSYRDPEDAQELLIHTAWNELK
AVSPLCRPAAEALLCNHLFQECSPGVVPTPMPICREYCLAVKELFCAKEWQAMEGKAHRG
LYRSGMHLLPVPECSKLPSMHRDPTACTRLPYLDYKKENITTFPSITSSRPSADIPNLPA
STSSFAVSPAYSMTVIISIVSSFALFALLTIATLYCCRRRKEWKNKKRESTAVTLTTLPS
ELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYE
PFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYG
DLNEFLRSMSPHTVCSLSHSDLSTRARVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKF
VHRDLATRNCLVGETMVVKIADFGLSRNIYSADYYKADGNDAIPIRWMPPESIFYNRYTT
ESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILACPENCPLELYNLMRLCWSK
LPADRPSFCSIHRILQRMCERAEGTVGV
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgagagagcttgtcaacattccactgttacagatgctcaccctggttgccttcagcggg
actgagaaacttccaaaagcccctgtcatcaccacgcctcttgaaactgtagatgccttg
gttgaagaagtagcgactttcatgtgtgccgtggaatcctaccctcagcccgagatttct
tggaccagaaataaaattctcattaagctgtttgacacccgctacagcatccgggagaat
ggtcagctcctcaccattctgagcgtggaagacagtgatgatggcatctactgctgcata
gccaacaatggagtgggaggagccgtggagagttgtggtgccctgcaagtgaagatgaaa
cctaaaataactcgtcctcccattaatgtaaaaataatagagggattgaaggcagttctg
ccgtgcactacgatgggtaaccccaaaccatctgtgtcctggatcaagggggacaatgct
ctcagggaaaattccagaatcgcagttcttgaatctgggagcttaaggatccataatgtg
caaaaggaagatgcaggacagtaccgctgtgtggccaaaaacagcctgggcacagcttac
tccaaactggtgaagctggaagtggaggtttttgcaagaatcctgcgtgctcctgaatcc
cacaatgtcacctttggttcctttgtaaccctacgctgcacagcaataggcatccctgtc
cccaccatcagctggattgaaaacggaaatgctgtttcttcaggttccattcaagagagt
gtgaaagaccgagtgattgactcaagactccagctcttcatcacaaagccaggactctac
acatgcatagctaccaataagcacggagaaaagttcagtaccgcaaaggctgcagccact
gtcagcatagcagaatggagtaagtcacagaaagacagccaaggctactgtgcccagtac
agaggggaggtgtgtgatgcagtcctggcgaaagatgctcttgtcttcttcaacacctcc
taccgggaccccgaggacgcccaggagctgctgatccacactgcgtggaatgagctgaag
gctgtgagtccactgtgccggccagctgctgaggctctgctgtgtaaccacctcttccaa
gagtgcagccctggagtggtacctactcccatgcccatttgcagagagtactgcctggcg
gtaaaggagctcttctgtgcaaaggaatggcaggcaatggaaggaaaggcccaccggggc
ctctacagatctgggatgcatctccttccggtaccagagtgcagcaagcttcccagcatg
caccgggaccccacagcctgcacaagactgccatatttagattataaaaaagaaaacata
acaacattcccgtcaataacgtcctccaggccgagcgcggacattccaaacctgcctgcc
tccacctcttcctttgccgtctcgcctgcgtactccatgaccgtcatcatctccatcgtg
tccagctttgccctgtttgctcttctcaccatcgctactctctattgctgccgaaggagg
aaagaatggaaaaataagaaaagagagtcgaccgcggtgaccctcaccacgttgccttcc
gagctcctgctggataggctccatcccaaccccatgtaccagaggatgccactccttctg
aatcctaagttgctcagcctggagtatccgaggaataacattgagtatgtccgagacatc
ggagagggggcgtttggaagagtcttccaagcaagggcccctggcttgctgccttatgaa
cctttcactatggtggccgtgaagatgcttaaggaagaggcctctgcagacatgcaagcg
gactttcagagggaggcggccctcatggcagagtttgacaaccccaacattgtgaaactc
ttaggtgtgtgtgccgttgggaagccgatgtgtctgctctttgaatatatggcctatggt
gacctcaatgagttcctccgaagtatgtccccgcacactgtttgcagcctcagccacagt
gacctgtccacgagggctcgggtgtctagccctggtcctccaccactgtcctgtgcagaa
cagctctgcattgccaggcaggtggcagctggcatggcctacctttcagagcgcaagttt
gtccaccgggacttagctaccaggaactgcctggttggggagaccatggtggtgaaaatt
gcagactttggcctctccaggaacatctattccgcagactactacaaagctgatggaaat
gacgccatccctatccgctggatgccgcccgagtctatcttctacaaccgctacaccact
gagtcggatgtatgggcctatggtgtggtcctctgggagatcttctcctatgggctgcag
ccctactatggaatggcccacgaggaggtcatttactatgtgagagatggcaacatcctc
gcctgccctgagaactgccccttggaactgtacaacctcatgcgcctgtgttggagcaag
ctgcctgctgatagacccagcttctgcagtatccacaggatcctgcagcgcatgtgcgag
agagcagagggaacggtgggtgtctaa

DBGET integrated database retrieval system