KEGG   Mus musculus (house mouse): 18203
Entry
18203             CDS       T01002                                 
Symbol
Ntan1, PNAA, PNAD
Name
(RefSeq) N-terminal Asn amidase
  KO
K14662  protein N-terminal asparagine amidohydrolase [EC:3.5.1.121]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    18203 (Ntan1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.121  protein N-terminal asparagine amidohydrolase
     18203 (Ntan1)
SSDB
Motif
Pfam: N_Asn_amidohyd FIST
Other DBs
NCBI-GeneID: 18203
NCBI-ProteinID: NP_035076
MGI: 108471
Ensembl: ENSMUSG00000022681
UniProt: Q64311 Q8BRX4
Position
16:13636629..13653314
AA seq 310 aa
MPLLVDGQRVRLPRSAVELVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPK
DGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGSDTKAEVPLIMSSIKSFSEHAECGR
LEVHLVGGFSDDRQLSQKLTHQLLSEFDKQDDDIHLVTLCVTELNDREENENHFPIIYGI
AVNIKTAEIYRASFQDRGPEEQLRAARALAGGPMISIYDAKTEQLRIGPCSWTPFPQVDF
WLQQDDKQILESLSTSPLAEPPHFVEHIRSTLMFLKKFPSPENILFPGNKALLYKKNKDG
LWEKISSPGS
NT seq 933 nt   +upstreamnt  +downstreamnt
atgccactgctggtggatgggcagcgcgtccgtctgccacggtccgctgtggagctggtc
cgggcgcacccgcctctggaggaaagagccagacttctcagaggtcagtctgttcaacaa
gtgggaccccagggccttctgtatgttcagcaaagagagcttgcagtgacctccccaaag
gatggctccatctccattctgggttctgatgatgctaccacttgtcacattgtagtcctg
agacatacaggaaatggggcaacctgcctgacacattgtgatggatctgacaccaaagct
gaagtccccttgataatgagctccataaaatccttctctgaacatgctgagtgtggaagg
ctggaagtacatcttgtgggaggcttcagtgatgacaggcagctgtcacagaaacttact
catcagcttctcagtgaatttgacaaacaggatgatgacattcacttagtgacattatgt
gtaacagagttaaatgaccgtgaagaaaatgaaaatcactttccaatcatttatggcatc
gctgtcaacattaaaactgcagagatttacagagcttcctttcaagatcgtggtccagag
gagcaactgcgtgctgcaagagctttagcaggaggcccaatgattagcatttatgatgca
aagacagaacaactccgaataggcccgtgttcctggacgccattcccacaagtggatttc
tggttgcagcaagatgacaagcaaatcctagagagcctttccacgtctcctctggccgag
cccccccactttgttgaacatattagatctaccttgatgtttttaaaaaaattcccatct
ccagagaatatactctttcctggaaataaagctctcctctacaaaaaaaataaagatggc
ttgtgggaaaagatctcctctccagggagctaa

DBGET integrated database retrieval system