KEGG   Mus musculus (mouse): 18207Help
Entry
18207             CDS       T01002                                 

Gene name
Nthl1, Nth1, Octs3
Definition
(RefSeq) nth (endonuclease III)-like 1 (E.coli)
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    18207 (Nthl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18207 (Nthl1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     18207 (Nthl1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     18207 (Nthl1)
 Prokaryotic Type
     18207 (Nthl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD HHH HHH_5 HHH_3
Motif
Other DBs
NCBI-GeneID: 18207
NCBI-ProteinID: NP_032769
MGI: 1313275
Ensembl: ENSMUSG00000041429
UniProt: O35980
Position
17; 17 A3.3
AA seq 300 aa AA seqDB search
MNSGVRMVTRSRSRATRIASEGCREELAPREAAAEGRKSHRPVRHPRRTQKTHVAYEAAN
GEEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASASPKVRRYQV
LLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRLIYPVGFWRNKVKYIKQT
TAILQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIAVDTHVHRIANRLRWT
KKMTKTPEETRKNLEEWLPRVLWSEVNGLLVGFGQQICLPVHPRCQACLNKALCPAAQDL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaggggtgcggatggtgactcgcagtcggagccgcgcgactaggatcgcgtcg
gaagggtgtagggaggagctcgccccgcgagaggctgctgcagaaggaagaaaaagccac
aggcccgtgagacatccacggagaacacagaaaacgcatgtggcctatgaagcggctaat
ggtgaggaaggcgaagatgctgagcccctcaaagtgcccgtttgggagccccagaactgg
cagcagcaactggccaacatccgcatcatgagaagcaagaaggatgcacctgtggaccag
ctaggcgccgagcactgctatgatgcaagtgcctccccgaaggtgaggaggtaccaggta
ctcctgtcgctgatgctctccagccagaccaaagaccaggtcacagcaggtgctatgcaa
cggctccgggcccggggcttgactgtggagagcatcctgcagaccgatgatgacacgcta
ggcagactcatctaccctgtgggcttctggaggaacaaggtaaaatacatcaagcagaca
accgccatcctgcagcagcgctacgaaggggacatccctgcttccgtggctgagctggta
gccttgccaggtgttgggcccaagatggcacacttggctatggctgtggcctgggggacc
atatcaggcatagcagtggacacacatgtgcacagaatagccaaccgactgaggtggacc
aagaagatgaccaagaccccagaagagacacgtaagaacttggaagagtggctacccagg
gtgctgtggagtgaggtcaacggactactggtaggcttcggccaacagatctgtcttcct
gtccatcctcgatgtcaggcttgcctcaacaaggccctgtgccctgctgcccaggatctc
taa

DBGET integrated database retrieval system