KEGG   Mus musculus (mouse): 18212Help
Entry
18212             CDS       T01002                                 

Gene name
Ntrk2, GP145-TrkB/GP95-TrkB, Tkrb, trk-B, trkB
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18212 (Ntrk2)
   04010 MAPK signaling pathway
    18212 (Ntrk2)
   04151 PI3K-Akt signaling pathway
    18212 (Ntrk2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18212 (Ntrk2)
 09160 Human Diseases
  09164 Substance dependence
   05034 Alcoholism
    18212 (Ntrk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18212 (Ntrk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18212 (Ntrk2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   18212 (Ntrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT C2-set_2 LRR_5 Haspin_kinase LRR_1
Motif
Other DBs
NCBI-GeneID: 18212
NCBI-ProteinID: NP_001020245
MGI: 97384
Ensembl: ENSMUSG00000055254
UniProt: P15209
Position
13 B1; 13 31.2 cM
AA seq 821 aa AA seqDB search
MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEP
NSVDPENITEILIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHI
NFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNES
SKNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTD
VADQSNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPL
HHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLK
RELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIV
KFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIA
AGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMP
PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQE
VYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctggctgaagtggcatggacccgccatggcgcggctctggggcttatgcctg
ctggtcttgggcttctggagggcctctctcgcctgcccgacgtcctgcaaatgcagttcc
gctaggatttggtgtactgagccttctccaggcatcgtggcattcccgaggttggaacct
aacagcgttgacccggagaacatcacggaaattctcattgcaaaccagaaaaggctagaa
atcatcaatgaagatgacgttgaagcttacgtggggctgagaaaccttacaattgtggat
tccggcttaaagtttgtggcttacaaagcgtttctgaaaaacagcaacctgcggcacata
aatttcacacgaaacaagctgacgagtttgtccaggagacatttccgccaccttgacttg
tctgacctgatcctgacgggtaatccgttcacgtgctcctgcgacatcatgtggctcaag
actctccaggagactaaatccagccccgacactcaggatttgtactgcctcaatgagagc
agcaagaacatgcccctggcgaacctgcagatacccaattgtggtctgccatctgcacgt
ctggctgctcctaacctcaccgtggaggaaggaaagtctgtgaccctttcctgcagtgtg
gggggtgacccactccccaccttgtactgggacgttgggaatttggtttccaagcacatg
aatgaaacaagccacacacagggctccttaaggataacgaacatttcatctgatgacagt
ggaaagcaaatctcttgtgtggcagaaaaccttgtaggagaagatcaagattctgtgaac
ctcactgtgcattttgcgccaactatcacgtttctcgagtctccaacctcagatcaccac
tggtgcattccattcactgtgagaggcaaccccaagcctgcgcttcagtggttctacaat
ggggccatactgaatgagtccaagtacatctgtactaagatccacgtcaccaatcacacg
gagtaccatggctgcctccagctggataaccccactcatatgaataacggagactacacc
ctgatggccaagaacgagtatgggaaggatgagagacagatctccgctcacttcatgggc
cggcctggagtcgactacgagacaaacccaaattaccctgaagtcctctatgaagactgg
accacgccaactgacattggggatactacgaacaaaagtaatgaaatcccctccacggat
gttgctgaccaaagcaatcgggagcatctctcggtctatgccgtggtggtgattgcatct
gtggtgggattctgcctgctggtgatgttgctcctgctcaagttggcgagacattccaag
tttggcatgaaaggcccagcttcggtcatcagcaacgacgatgactctgccagccccctc
caccacatctccaatgggagtaacactccatcttcttcggagggcggtcccgacgctgtc
attattggaatgaccaagattcctgttattgaaaacccccagtactttggcatcaccaac
agtcagctcaagccagacacatttgttcagcatatcaagagacacaacatcgttctgaag
agggaacttggggaaggagccttcgggaaagttttccttgccgagtgctacaacctctgc
ccagagcaggataagatcctggtggctgtgaagacgctgaaggacgccagcgacaatgca
cgcaaggactttcatcgggaagctgagctgctgaccaacctccagcacgagcacattgtc
aagttctacggtgtctgtgtggagggcgacccactcatcatggtctttgagtacatgaag
cacggggacctcaacaagttccttagggcacacgggcccgacgcagtgctgatggcagag
ggtaacccgcccacagagctgacgcagtcgcagatgctgcacatcgctcagcaaatcgca
gcaggtatggtctacctggcgtcccaacactttgtgcaccgtgacctggccacccggaac
tgcctggtgggagagaacctgctggtgaaaattggggactttgggatgtcccgagatgtg
tacagcaccgactactatcgggtcggtggccacacaatgttgcccatccgatggatgcct
ccagagagcatcatgtacaggaaattcaccaccgagagcgacgtctggagcctgggcgtt
gtgttgtgggagatcttcacctacggcaagcagccctggtatcagctatcgaacaatgag
gtgatagagtgcatcacccagggaagagtccttcagcggcctcgaacgtgtccccaggag
gtgtatgagctcatgcttggatgctggcagcgggaaccacacacccggaagaacatcaag
agcatccacaccctccttcagaacttggccaaggcatctcccgtctacctggatatccta
ggctag

DBGET integrated database retrieval system