KEGG   Mus musculus (mouse): 18213
Entry
18213             CDS       T01002                                 

Symbol
Ntrk3, AW125844, Ntrk3_tv3, TrkC
Name
(RefSeq) neurotrophic tyrosine kinase, receptor, type 3
  KO
K05101  neurotrophic tyrosine kinase, receptor type 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18213 (Ntrk3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18213 (Ntrk3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    18213 (Ntrk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18213 (Ntrk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18213 (Ntrk3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   18213 (Ntrk3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set LRRCT_2 Ig_3 ig LRR_8 Ig_2 C2-set_2 LRRNT LRR_5 LRR_4 TrkA_TMD Haspin_kinase LRR_6
Other DBs
NCBI-GeneID: 18213
NCBI-ProteinID: NP_032772
MGI: 97385
Ensembl: ENSMUSG00000059146
Vega: OTTMUSG00000021139
UniProt: Q6VNS1 Q3TNY3
Position
7:complement(77825711..78228865)
AA seq 825 aa
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRGLHTLNAVDMELYTGLQKLTIKNSGLRNIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEA
RLDSQSLYCISADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHMDYYQEGEVSE
GCLLFNKPTHYNNGNYTLIAKNALGTANQTINGHFLKEPFPESTDFFDFESDASPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRVGGHTMLPI
RWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRV
CPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggatgtctctctttgcccagccaagtgtagtttctggcggattttcttgctgggaagc
gtctggctggactatgtgggctccgtgctggcttgccctgcaaattgtgtctgcagcaag
actgagatcaattgccggcggccggacgatgggaacctcttccctctcctggaagggcag
gattcagggaacagcaatgggaacgccagcatcaacattacggacatctcaaggaatatc
acttccatacacatagagaactggcgaggcctgcacacactcaatgctgtggacatggag
ctctacacgggactccagaagctgaccatcaagaattctggactccggaacatccagccc
agagccttcgccaagaacccccacttgcgttatataaacttgtcaagtaaccggctcacc
acactctcctggcagctcttccagacgctgagccttcgggaattgagactggagcagaac
ttcttcaactgcagctgtgacatccgctggatgcagctgtggcaggaacagggggaggcg
cggctggacagccagagcctttactgcatcagtgctgatggctcccaactccccctcttc
cgcatgaacatcagtcagtgtgatctcccagagatcagtgtgagccacgtcaacctgact
gtccgagaaggagacaatgccgtgatcacttgcaatggctctggctctcctttgcctgat
gtggactggatagtcactgggctgcagtccatcaacacccaccagaccaatctgaactgg
accaatgtacatgccatcaacttgaccctggtgaacgtgacgagcgaggacaatggcttc
accctgacgtgcattgcagagaacgtggtgggcatgagcaatgccagtgttgctctcact
gtctactaccctccacgtgtggtgagcctggtggagcctgaggtacgcctggaacattgc
attgagtttgtggtgcgtggcaacccgacacccacgctccactggctgtacaatggacag
ccattgagggagtccaagatcattcacatggactactaccaggagggggaggtctcagag
ggctgcctgctcttcaacaagcccacccactacaacaatggcaactacaccctcattgct
aagaatgccctgggcacggccaaccagaccatcaacggccacttcctgaaggagcccttt
ccagagagcacagatttctttgactttgagtctgatgcgagccctacacctcctatcact
gtgacccacaaaccagaggaagacacttttggggtgtccatagcagtcggacttgctgcc
tttgcctgcgtccttctggtggttctctttatcatgatcaacaagtatggtcgccggtcc
aaatttggaatgaagggtcctgtggctgttatcagtggagaggaggactcagccagccca
ctgcatcacatcaaccatggcatcactacaccatcatcgttggatgctgggcctgacaca
gtggtcattggcatgacccgcatcccagtcattgagaacccccagtacttccgtcagggt
cacaattgccacaagccagacacatatgttcagcacatcaagaggagagacatcgtgttg
aagagagaattgggtgagggagcctttgggaaggtcttcctggctgagtgctacaatcta
agccccaccaaagacaagatgctagtggcagtgaaggccctgaaggatcccaccttggct
gccaggaaggatttccagagggaggctgagctgctcacgaacctgcagcatgagcatatt
gtcaagttctatggggtgtgtggtgatggtgacccactcatcatggtctttgaatacatg
aagcatggagaccttaacaagttcctcagggcccatgggccagatgccatgatcctcgtg
gatggacagccacgtcaggccaagggggagctagggctctctcagatgctccacatcgcc
agtcagatagcctcgggcatggtgtacctggcttcccagcactttgtacaccgggacctg
gccacgaggaactgcctggttggagccaatctactagtgaagattggagattttggcatg
tccagggacgtctacagtactgattactacagggtgggaggacacaccatgctccccatc
cgctggatgccccctgaaagcataatgtaccggaagttcaccacagagagtgatgtctgg
agcttcggggttattctttgggagatctttacctatgggaagcaaccatggttccagctt
tccaacacggaggtcattgaatgcatcacccaaggccgtgtcttggagagacccagagtc
tgccctaaagaagtgtatgatgtcatgctggggtgctggcagagggaaccacagcagcgg
ctgaatattaaggagatctacaaaatcctccatgctttggggaaggccaccccgatctac
ctggacattcttggctag

DBGET integrated database retrieval system