KEGG   Mus musculus (mouse): 18222
Entry
18222             CDS       T01002                                 

Symbol
Numb, Nb, m-num
Name
(RefSeq) NUMB endocytic adaptor protein
  KO
K06057  numb
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18222 (Numb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18222 (Numb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    18222 (Numb)
SSDB
Motif
Pfam: PID NumbF PTB PID_2
Other DBs
NCBI-GeneID: 18222
NCBI-ProteinID: NP_001129547
MGI: 107423
Ensembl: ENSMUSG00000021224
Vega: OTTMUSG00000031495
UniProt: Q9QZS3
Structure
PDB: 
5YQG 1WJ1

Position
12; 12 D1
AA seq 653 aa
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPS
SPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNTVPEVEGEAESISSLCSQITSAFSTPSEDPFSSAPMTKPVTLVAP
QSPVLQANGTDSASHVLTAKPANTALAHVAMPVRETNPWAHVPDAANKEIAAIHPGTEWG
QSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQVSAAPLQPVLQPPPPAAIAPP
APPFQGHAFLTSQPVPVGVVPPLQPAFVPTQSYPVANGMPYPASNVPVVGITPSQMVANV
FGTAGHPQTTHPHQSPSLAKQQTFPQYETSSATTSPFFKPPAQHLNGSAAFNGVDNGGLA
SGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTFEIEL
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaacaaactacggcaaagcttcaggagaaagaaagacgtttatgtcccagaggccagc
cgtccacatcagtggcagacagatgaagaaggagtccgcactggaaagtgtagcttccca
gttaagtacctcggccacgtagaagttgatgagtcaagaggaatgcacatctgtgaagat
gccgtaaagagattgaaagctgaaaggaagttcttcaaaggcttctttggaaaaacggga
aagaaagcagtgaaggccgttctgtgggtgtcagcggatgggctcagagttgtggacgag
aaaactaaggacctcatagttgaccagacaatagaaaaagtttccttctgtgccccagat
aggaactttgacagagccttttcttacatatgtcgtgatggcaccactcggcgatggatc
tgtcattgtttcatggctgtcaaagacacgggggaaagactgagccacgccgtgggctgt
gcttttgcagcctgtttagagcgtaaacagaagcgggagaaggagtgtggcgtcactgct
acttttgatgccagtagaaccactttcacaagagaaggatcattccgtgtcacaactgcc
actgagcaagccgaaagagaggagatcatgaaacagttgcaagatgccaagaaagctgag
acagacaagacagttgttggtccatcagtggctcctggcaacactgctccatccccatcc
tctcccacctctcccactccggatggcactgcatcttcagagatgaacaatccccatgct
atcccacgccggcatgcaccaattgaacagcttgctcgtcaaggctctttccggggattt
cctgctcttagccagaagatgtcaccctttaaacgccagctgtccctacgcatcaatgag
ttgccttccactatgcagaggaagaccgatttcccaataaaaaacacagtgcccgaggtg
gaaggagaggccgagagcatcagctccttgtgttcccagatcaccagtgccttcagcacg
ccctctgaggaccccttctcctccgccccaatgaccaaaccagtgacattggtggcacca
cagtctcctgtgttacaagctaatggcactgactcagcctcccatgtgcttactgctaag
ccagccaatactgctctagcacacgtagcaatgcctgtccgtgaaaccaacccctgggcc
catgtccctgatgctgctaacaaggaaattgcagccatacatccggggactgagtggggt
cagtcttctggtgctgcctctccaggtctcttccaggctggtcacagacgcactccctct
gaagctgaccgctggttagaagaagtgtcaaagagtgtgcgggcccagcagcctcaggtc
tcagctgcccctctgcagccagttctccagccgcctccgcccgccgccattgcccctcca
gcacctcctttccaaggacatgccttcctcacgtcccagcctgtgcccgtgggtgtggtc
ccacccctacaaccagcctttgtccctacccagtcctaccctgtggccaacgggatgccc
tacccagcctctaatgtgcctgtagtgggcatcaccccatcccagatggtagccaatgtg
tttggcactgcaggccaccctcagacaactcatccacatcagtcgccaagcctggccaag
cagcagacattccctcaatatgagacaagtagtgctaccaccagtcccttctttaagcct
cctgctcagcacctcaatggttctgcagctttcaatggtgtagacaatggtgggctagcc
tcaggaaacaggcatgcagaagtccctccaggcacctgcccagtggatcctttcgaagct
cagtgggccgcactagaaagcaagtccaagcagcgtacaaatccttctcctaccaaccct
ttctccagtgacttacagaaaacatttgaaatagaactttag

DBGET integrated database retrieval system