KEGG   Mus musculus (house mouse): 18222
Entry
18222             CDS       T01002                                 
Symbol
Numb, Nb
Name
(RefSeq) NUMB endocytic adaptor protein
  KO
K06057  numb
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18222 (Numb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18222 (Numb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    18222 (Numb)
SSDB
Motif
Pfam: PID NumbF PTB PID_2
Other DBs
NCBI-GeneID: 18222
NCBI-ProteinID: NP_001129547
MGI: 107423
Ensembl: ENSMUSG00000021224
UniProt: Q9QZS3
Structure
Position
12:complement(83840808..83968713)
AA seq 653 aa
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPS
SPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNTVPEVEGEAESISSLCSQITSAFSTPSEDPFSSAPMTKPVTLVAP
QSPVLQANGTDSASHVLTAKPANTALAHVAMPVRETNPWAHVPDAANKEIAAIHPGTEWG
QSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQVSAAPLQPVLQPPPPAAIAPP
APPFQGHAFLTSQPVPVGVVPPLQPAFVPTQSYPVANGMPYPASNVPVVGITPSQMVANV
FGTAGHPQTTHPHQSPSLAKQQTFPQYETSSATTSPFFKPPAQHLNGSAAFNGVDNGGLA
SGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTFEIEL
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaacaaactacggcaaagcttcaggagaaagaaagacgtttatgtcccagaggccagc
cgtccacatcagtggcagacagatgaagaaggagtccgcactggaaagtgtagcttccca
gttaagtacctcggccacgtagaagttgatgagtcaagaggaatgcacatctgtgaagat
gccgtaaagagattgaaagctgaaaggaagttcttcaaaggcttctttggaaaaacggga
aagaaagcagtgaaggccgttctgtgggtgtcagcggatgggctcagagttgtggacgag
aaaactaaggacctcatagttgaccagacaatagaaaaagtttccttctgtgccccagat
aggaactttgacagagccttttcttacatatgtcgtgatggcaccactcggcgatggatc
tgtcattgtttcatggctgtcaaagacacgggggaaagactgagccacgccgtgggctgt
gcttttgcagcctgtttagagcgtaaacagaagcgggagaaggagtgtggcgtcactgct
acttttgatgccagtagaaccactttcacaagagaaggatcattccgtgtcacaactgcc
actgagcaagccgaaagagaggagatcatgaaacagttgcaagatgccaagaaagctgag
acagacaagacagttgttggtccatcagtggctcctggcaacactgctccatccccatcc
tctcccacctctcccactccggatggcactgcatcttcagagatgaacaatccccatgct
atcccacgccggcatgcaccaattgaacagcttgctcgtcaaggctctttccggggattt
cctgctcttagccagaagatgtcaccctttaaacgccagctgtccctacgcatcaatgag
ttgccttccactatgcagaggaagaccgatttcccaataaaaaacacagtgcccgaggtg
gaaggagaggccgagagcatcagctccttgtgttcccagatcaccagtgccttcagcacg
ccctctgaggaccccttctcctccgccccaatgaccaaaccagtgacattggtggcacca
cagtctcctgtgttacaagctaatggcactgactcagcctcccatgtgcttactgctaag
ccagccaatactgctctagcacacgtagcaatgcctgtccgtgaaaccaacccctgggcc
catgtccctgatgctgctaacaaggaaattgcagccatacatccggggactgagtggggt
cagtcttctggtgctgcctctccaggtctcttccaggctggtcacagacgcactccctct
gaagctgaccgctggttagaagaagtgtcaaagagtgtgcgggcccagcagcctcaggtc
tcagctgcccctctgcagccagttctccagccgcctccgcccgccgccattgcccctcca
gcacctcctttccaaggacatgccttcctcacgtcccagcctgtgcccgtgggtgtggtc
ccacccctacaaccagcctttgtccctacccagtcctaccctgtggccaacgggatgccc
tacccagcctctaatgtgcctgtagtgggcatcaccccatcccagatggtagccaatgtg
tttggcactgcaggccaccctcagacaactcatccacatcagtcgccaagcctggccaag
cagcagacattccctcaatatgagacaagtagtgctaccaccagtcccttctttaagcct
cctgctcagcacctcaatggttctgcagctttcaatggtgtagacaatggtgggctagcc
tcaggaaacaggcatgcagaagtccctccaggcacctgcccagtggatcctttcgaagct
cagtgggccgcactagaaagcaagtccaagcagcgtacaaatccttctcctaccaaccct
ttctccagtgacttacagaaaacatttgaaatagaactttag

DBGET integrated database retrieval system