KEGG   Mus musculus (mouse): 18226
Entry
18226             CDS       T01002                                 

Symbol
Nup62, D7Ertd649e, Nupc1, p62
Name
(RefSeq) nucleoporin 62
  KO
K14306  nuclear pore complex protein Nup62
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    18226 (Nup62)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    18226 (Nup62)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18226 (Nup62)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     18226 (Nup62)
SSDB
Motif
Pfam: Nsp1_C DUF4164 Exonuc_VII_L Pam17 Nup188_C
Other DBs
NCBI-GeneID: 18226
NCBI-ProteinID: NP_444304
MGI: 1351500
Ensembl: ENSMUSG00000109511
Vega: OTTMUSG00000021116
UniProt: Q63850 Q5FWJ9
Position
7:44465512..44481260
AA seq 526 aa
MSGFNFGGTGAPAGGFTFGTAKTATTTPATGFSFSASGTGTGGFNFGTPSQPAATTPSTS
LFSLTTQTPTTQTPGFNFGTTPASGGTGFSLGISTPKLSLSNAAATPATANTGSFGLGSS
TLTNAISSGSTSNQGTAPTGFVFGSSTTSAPSTGSTGFSFTSGSASQPGASGFSLGSVGS
SAQPTALSGSPFTPATLVTTTAGATQPAAAAPTAATTSAGSTLFASIAAAPASSSATGLS
LPAPVTTAATPSAGTLGFSLKAPGAAPGASTTSTTTTTTTTTTTAAAAAASTTTTGFALS
LKPLVSAGPSSVAATALPASSTAAGTATGPAMTYAQLESLINKWSLELEDQERHFLQQAT
QVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKE
QSGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNMAGGPADTSDPLQQICK
ILNAHMDSLQWVDQSSALLQRRVEEASRVCEGRRKEQERSLRIAFD
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgagtggatttaactttggaggcaccggggctcctgctggcggctttacatttgggacc
gcaaagactgcgaccaccacacctgccactggcttttccttctctgcttctggcaccggc
accggagggtttaattttgggactccctcccagccagctgcgaccaccccttccaccagc
ctcttctcactcaccacacagaccccaaccacacagaccccaggattcaactttggaaca
acacctgcttctggaggaacaggcttctccctggggatcagcaccccaaagctcagcctg
agtaacgcagctgccacaccagccacggccaacactggcagctttgggcttggcagcagc
accctcaccaatgccatctcaagtggcagcacctccaaccaggggacagcccccactggc
tttgtctttggctcttctaccacctctgctccgtccaccggctccactgggttctcattc
accagtggcagtgcatcccagcctggagcctctggcttcagccttggctctgtgggtagc
tctgcccagcccacagcactgtctggctctcccttcacaccagccactctggtgactact
acagcaggagctacacagccagctgctgctgcacccactgctgccaccaccagtgcaggg
tctacactctttgcttccatagctgctgctcctgcctcatccagtgctacagggctctcc
ctcccagctccggtgacaactgcagcaactcctagtgctgggactttgggcttcagcctc
aaggcccctggagcagctcctggtgcctccaccaccagcaccaccactaccactaccacc
actactaccactgctgctgccgctgccgcctctaccacaaccactggctttgccttaagt
ctgaaacccctggtgtcagctggccccagcagtgtagcagctactgctctgcctgcctcc
agcacagcagctgggactgccacaggtccagcgatgacctatgcacagctggaaagcttg
atcaacaagtggagtctggagctggaagatcaggagcggcacttcctgcagcaggccaca
caggtcaatgcctgggaccgcacactgattgagaatggggagaagatcaccagcctgcac
cgagaggtggaaaaggtgaagctggatcagaagcgactggaccaggagctggactttatc
ctgtcgcagcagaaggagctggaagacctcctgagcccattggaggagtcagtgaaggag
caaagtggcaccatataccttcagcacgctgatgaggagcgtgagaagacctacaagctg
gctgagaacattgatgctcagctcaagcgcatggcacaggacctcaaggatatcatcgag
cacctgaacatggctggtggccctgcagacaccagtgacccattgcaacagatctgcaag
atcctcaatgcacacatggactctcttcagtgggtggaccagagctctgccctgctgcag
aggagggtggaggaggctagccgtgtatgtgagggccggcgcaaggaacaggagcgcagt
ctgcgcattgcctttgactag

DBGET integrated database retrieval system