KEGG   Mus musculus (mouse): 18245Help
Entry
18245             CDS       T01002                                 

Gene name
Oaz1, AZ-1, AZ1, Antizyme, ODC-Az, Oaz
Definition
(RefSeq) ornithine decarboxylase antizyme 1
  KO
K16548  ornithine decarboxylase antizyme 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    18245 (Oaz1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     18245 (Oaz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ODC_AZ
Motif
Other DBs
NCBI-GeneID: 18245
NCBI-ProteinID: NP_032779
MGI: 109433
Ensembl: ENSMUSG00000035242
Vega: OTTMUSG00000042344
UniProt: P54369
Position
10 C1; 10 39.72 cM
AA seq 227 aa AA seqDB search
MVKSSLQRILNSHCFAREKEGDKRSATLHASRTMPLLSQHSRGGCSSESSRVALNCCSNL
GPGPRWCSDVPHPPLKIPGGRGNSQRDHSLSASILYSDERLNVTEEPTSNDKTRVLSIQS
TLTEAKQVTWRAVWSGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLQADHVFICFPKNR
EDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLEREDPGEED
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaatcctccctgcagcggatcctcaacagccactgcttcgccagagagaaggaa
ggggacaaacgcagcgccacgcttcacgccagccgcaccatgccgcttcttagtcagcac
agccgcggcggctgcagcagcgagagttctagggttgcccttaattgctgtagtaacctg
ggtccggggcctcggtggtgctccgatgtccctcacccacccctgaagatcccaggtggg
cgagggaacagtcagcgggatcacagtctttcagctagcatcctgtactccgacgagcgg
ctgaatgtgacagaggagccgacgtctaacgacaagaccagggtcctgagcatccagtcc
acgctcacggaggccaagcaggtcacctggagggcggtgtggagtggtggtggcctctac
atcgagctcccagctggacctctgcctgagggcagtaaggacagttttgcagctctccta
gagttcgcagaggagcaactccaggctgaccacgttttcatctgcttccccaagaaccgt
gaggacagagccgccctactccgaaccttcagctttcttggctttgagattgtgagaccc
gggcatccccttgtccccaagagacccgacgcttgcttcatggtctacactctggagaga
gaggacccgggtgaggaggactag

DBGET integrated database retrieval system