KEGG   Mus musculus (mouse): 18256Help
Entry
18256             CDS       T01002                                 

Gene name
Oc90, Ocn-95, PLA2L, Pla2ll, oc95
Definition
(RefSeq) otoconin 90
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 18256
NCBI-ProteinID: NP_035083
MGI: 1313269
Ensembl: ENSMUSG00000015001
Vega: OTTMUSG00000024544
UniProt: Q9Z0L3
Position
15 D1; 15 29.16 cM
AA seq 485 aa AA seqDB search
MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVFKNVESVAEIFDCLGS
HFTWLQAVFTNFPLLLQFVNSMRCVTGLCPRDFEDYGCACRFEMEGMPVDESDICCFQHR
RCYEEAVEMDCLQDPAKLSADVDCTNKQITCESEDPCERLLCTCDKAAVECLAQSGINSS
LNFLDASFCLPQTPETTSGKAATLLPRGIPEKPTDTSQIALSGEVAGEVRADTLTTLSRT
KSVQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKPLRLGVSSVDNGSQEAAGKACDR
LAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYCGREGRGEPRDTLDRCCLSHH
CCLEQMRQVGCLHGRRSQSSVVCEDHMAKCVGQSLCEKLLCACDQMAAECMASAFFNQSL
KSPDGAECQGEPVSCEDGMLQGTLASSVDSSSEENSEEAPPQMERLRRFLEKPPGPLGAR
PLGGK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgattatgctgctcatggtcggtatgctgatggccccctgtgttggggcccatgctctg
gacacaccaaatccccaggaattgcctccaggactgtcaaaaaatataaatatcactttc
ttcaatggagtgtttaaaaacgtggaaagtgtggctgaaatttttgactgcctaggttcc
cacttcacctggctgcaggctgtcttcaccaacttcccgctgctcctccagtttgtaaac
agtatgaggtgtgtaactggcctctgcccccgggactttgaagactatggttgtgcctgt
aggtttgagatggaagggatgcctgtggacgagtctgatatctgctgcttccagcatcgc
aggtgctatgaggaagctgttgagatggactgtctccaagaccctgccaagctcagtgca
gatgtggattgcaccaacaaacagatcacatgtgagtccgaggatccctgtgagcgtcta
ctgtgtacgtgtgacaaggctgctgtggagtgcctggctcagtctggcatcaactcctcc
ctgaacttcctggatgcttccttctgcctccctcagactccagagacaactagtgggaag
gctgcaacactgttgcctagagggattcctgaaaagcccacagataccagtcagatagcc
ctgtcaggagaagtggctggtgaggtgagagcagacacactaacaaccctctccagaaca
aagtctgttcaagatcttcaagacacacaagcttctaggaccacatcaagtccaggatct
gcagagattattgccctagccaaaggtacaacccactctgctggcatcaaaccactgagg
ttgggagtctcatctgttgacaatggttcccaggaagcagctggaaaagcctgtgacaga
ttggccttcgtgcatctgggtgatggggacagcatgacggccatgctgcagcttggagag
atgctcttctgtctaacatcccattgcccagaggaatttgaaacttacggctgctactgt
ggaagagaaggaagaggagagccaagggacaccctggataggtgctgtctgtcccatcac
tgctgtttggagcagatgagacaagtgggctgcctccatggaaggcgttctcagtcatct
gtggtatgtgaagaccacatggccaaatgtgtggggcagagcctgtgtgagaagctacta
tgtgcctgtgaccagatggcagctgagtgcatggcctctgccttctttaatcaaagcctc
aagtcaccagacggagccgagtgtcaaggcgagcctgtgtcctgtgaggatggcatgctc
cagggcaccttggcctcttctgtggactccagttctgaggagaatagtgaggaagctcca
ccgcagatggaacgcctaagaagatttctggaaaagcctcctggtcccttgggggccaga
cccctcggtgggaaataa

DBGET integrated database retrieval system