KEGG   Mus musculus (mouse): 18286
Entry
18286             CDS       T01002                                 

Symbol
Odf2, AI848335, MMTEST29
Name
(RefSeq) outer dense fiber of sperm tails 2
  KO
K16479  outer dense fiber protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    18286 (Odf2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    18286 (Odf2)
SSDB
Motif
Pfam: Mt_ATP-synt_D NAT Filament ADIP Crescentin
Other DBs
NCBI-GeneID: 18286
NCBI-ProteinID: NP_001171130
MGI: 1098824
Ensembl: ENSMUSG00000026790
Vega: OTTMUSG00000019165
UniProt: A3KGV1
Position
2 B; 2 20.79 cM
AA seq 826 aa
MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSAASSQKSHKRGMKGDTVNVRRSVRVKTKV
PWMPPGKSSARHVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDK
KIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIER
IKEEKDFTMLQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTD
INTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEKDSERLMEQQGTLLKRLAEADSEK
ARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRCKEAENSRLC
MQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKETLKKAIRAQKERAEKSEEYAEQLH
VQLADKDLYVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVTDLVNQQQSLEEKMR
EDRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMID
NYKSQVMKTRLEADEVAAQLERCDKENKMLKDEMNKEIEAARRQFQSQLADLQQLPDILK
ITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSQ
KVDELERKLEATSAQNVEFLQVIAKREEAIHQAQLRLEEKTRECGSLARQLESAIEDARR
QVEQTKEQALSKERAAQSKILDLETQLSRTKTELGQLRRTRDDADRRYQSRLQDLKDRLE
QSESTNRSMQNYVQFLKASYANVFGDAPYTSSYLTSSPIRSRSPPA
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgaaggaccgatcttcaactccccccttacatgttcacgtggatgagaacactcctgtc
cacgtccacataaaaaaactcccgaaaccgtcagcagccagcagccagaaatctcataag
cgcggaatgaaaggggacaccgtgaatgtacggcggagtgtccgggtgaaaaccaaggta
ccttggatgccccctggaaaatcatctgcccggcatgtgggatgcaagtgggagaatcca
cctcattgcctggagatcacaccaccatcttcagaaaagctggtctcggtgatgcgatta
agtgacctttctacagaagacgacgattcaggtcactgtaaaatgaaccgttacgataag
aagattgacagtctaatgaacgcggtcggttgtctcaaatctgaggtcaagatgcagaaa
ggtgaacgccaaatggccaaaaggttcctggaggagaggaaggaagagctggaggaggtg
gcacacgagcttgcagagacggagcatgagaacacggtgctcagacacaacatcgagcgt
atcaaggaggagaaggacttcaccatgcttcaaaagaaacacctccagcaggagaaggaa
tgcctcatgtccaaactagtggaggctgaaatggatggagcagctgctgccaagcaggtc
atggccttgaaggataccatcgggaagctgaaaaccgagaaacagatgacttgcaccgac
atcaacaccttaacaaggcagaaggaacttctcctgcagaagctgagtacctttgaggag
accaatcgcaccctccgagatctgttgagggaacagcactgcaaagagaaggattccgag
agactaatggagcaacaaggtacattactgaagcgtctggcagaggcagactcagagaaa
gcgcgcctgctgttactactgcaagacaaggacaaggaggtggaagaactcctccaggag
atacaatgtgaaaaggctcaagcaaagacagcgtctgagctttccaagtccatggagtcc
atgcgggggcatttgcaggcacagcttcgctgcaaagaggctgagaacagtcgcctgtgc
atgcagatcaagaacttagagcgcagtgggaaccagcataaggcggaagtagaggccatc
atggagcagctaaaggaactgaagcagaagggagaccgagacaaagagaccctaaagaag
gccatccgagcccagaaagagcgagccgagaagagtgaggagtatgccgagcagctgcat
gtgcaactggccgacaaggacctttatgttgctgaagctttatctactctggagtcttgg
aggagccgttacaaccaggttgtgaaggacaaaggagatcttgagttggagattatcgtc
ctaaatgaccgggtgacagatcttgtaaaccaacaacaaagcttggaggagaagatgcgg
gaagaccgggacagcttggtagagaggctgcaccggcagacggctgagtactctgcattc
aagctagagaacgagaggctcaaggctagctttgcccctatggaggacaagctcaaccag
gctcacttggaggttcagcagctgaaggcgtcagtgaagaactacgaggggatgatagac
aactacaagagccaggtgatgaaaacaagattggaggctgatgaagtggctgcacagcta
gagcgctgcgacaaagagaacaagatgcttaaagacgagatgaacaaagagatcgaggcg
gcccgtcggcagttccagtcacagctggctgacctacaacagctgcctgacatcctcaag
atcacggaggccaagctggctgagtgccaagaccagctgcagggctacgagaggaagaac
atcgacctcacagccatcatttcagacctgcgcagccggatcgaacatcagggggacaag
ctggagatggcgagagagaaacatcaggcttcccagaaggaaaataaacagctgagtcag
aaggtggatgaacttgagaggaaactggaggctaccagcgcccagaatgtcgagttccta
caggtgattgccaagagggaggaggcaatccaccaggctcagctgcggttggaggagaaa
acgagggagtgtgggtcattggcgaggcagttggagagtgccattgaagatgccaggcga
caggtggagcaaaccaaggaacaggcactctccaaggaacgagcagcccagagcaaaatc
ctggaccttgagactcagctgagcaggaccaagacagaacttggccagctgcggcggact
cgtgatgatgcggatcgcagataccagagccgcctgcaggatctgaaagatcgcctggag
cagtctgagagtaccaaccgcagcatgcagaattatgtccaattcctcaaggcctcttat
gcaaatgtgtttggggatgctccctatacatcctcctacctgacgagctcacccatccgc
tcccgatcgccccctgcctga

DBGET integrated database retrieval system