KEGG   Mus musculus (house mouse): 18291
Entry
18291             CDS       T01002                                 
Symbol
Nobox, OG2, Og2x
Name
(RefSeq) NOBOX oogenesis homeobox
  KO
K24199  homeobox protein NOBOX
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18291 (Nobox)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    18291 (Nobox)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN DUF4552
Other DBs
NCBI-GeneID: 18291
NCBI-ProteinID: NP_570939
MGI: 108011
Ensembl: ENSMUSG00000029736
UniProt: Q8VIH1
Position
6:complement(43280608..43287006)
AA seq 527 aa
MEPTEKLCKKMQGQEAGDKPRTAALETEGPLQDSALPIQDDQDKQSSLPRASLGKRPLSK
TSEELMDAGTCRVHKAPTAAACGPQSEEEGCSPPERKAESLKPSISAVPGQATAGSLNSH
EGDLKKESLEVTCQFRKKTRTLYRSDQLEELERIFQEDHYPDSDKRHEISQMVGVTPQRI
MVWFQNRRAKWRKVEKLNEKETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENI
LDVFPEPPMLLTSEQTLTPFQNNEGAERVAVTPPLLSPPPIRRANLPLPLGPVQTPQVLP
PMRDVPGSDSIYKDKAYVSWGTSIASPPTYSNLEDLGSQDYQASSQLGSFQLSQAPHLPL
FPSLQSQFPYLPPFPYPIPSSMPFLPPEDSLFSFPFGFSGDSSQDYCPGPPPGQILLQPP
AENMGTGPWSGHCLPEPPFPRPHYPQALGQPLGAEGYFPNLLPTPYALTMSKQSSLGLNG
LLEGTRVETGSSLSKMSDEQTSSSLEQPALEEVRDKNKNSHAAGAKE
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggaacctacggagaagctctgcaagaaaatgcagggccaggaagctggtgacaagccc
aggactgctgcactggagacagagggaccactgcaggattctgccctgcccatccaggat
gatcaagacaagcagtcctcactccccagggctagcttggggaagaggccactgtcgaag
acctctgaggagttaatggatgctggcacgtgcagagtgcacaaagcccccacagcagcc
gcatgtggtccccaatccgaggaagaaggttgttctcccccagagagaaaggcagaatcg
ctgaagccatccatttctgcagtccctggccaagccaccgccggttccctcaactctcat
gaaggggacctgaagaaagaatccctagaagtgacctgtcaatttcggaaaaagacccga
accctgtaccgctcagaccagctggaagaactggagaggatatttcaggaagaccactat
cctgacagtgacaaacgccatgagatttcccagatggtgggggtaaccccccaaagaatc
atggtgtggtttcagaaccgcagggcaaagtggagaaaagtggagaaactgaacgagaag
gaaactaagaatggtcctgcagcccccagtgctgacagcagccagcacagatctgctcct
gagctcctagaccctatgcctacagacctagaacctggccctgttcctccagagaacatc
ctggatgtctttcctgagccccccatgctgctgacttctgaacagactctgacccccttt
cagaataatgagggtgctgagagggtggcagtgactccaccactcctcagtcccccacct
attcgaagggccaaccttcctcttcctctgggtcctgttcaaactcctcaagtactgcct
ccaatgagggacgttcctggcagtgacagcatatacaaggacaaggcctatgtgtcctgg
ggcactagtatcgcctcaccacccacctactcaaatttggaagacctggggtctcaggac
taccaagcaagcagccagttgggttcattccagctctcccaggctccacatttacccctt
ttcccatcccttcagtcacagtttccgtatctgccccccttcccttaccccatcccaagc
tcaatgccatttctaccaccagaagactctctgttttcatttccttttggcttcagtgga
gactcatcacaggattattgcccaggacccccaccaggtcagatcttgctgcagccacct
gctgaaaacatgggtacaggaccctggagtggccattgcttgccagaacctcccttccct
cgtccacactacccacaggctctgggacaacccctaggggcagagggttactttcctaac
ctattgccaactccatatgctctgactatgagtaagcagtcttcattaggcctcaatggg
cttctcgaaggcactagagtagagaccgggtcctcactaagcaaaatgtcagatgagcag
acttcctcttccctcgagcagcccgcactagaggaggtcagagacaaaaataagaatagc
catgccgctggagctaaagagtaa

DBGET integrated database retrieval system