KEGG   Mus musculus (mouse): 18292
Entry
18292             CDS       T01002                                 

Gene name
Sebox, OG9, Og9x
Definition
(RefSeq) SEBOX homeobox
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 18292
NCBI-ProteinID: NP_032785
MGI: 108012
Ensembl: ENSMUSG00000001103
Vega: OTTMUSG00000000145
UniProt: P70368
Position
11 B5; 11 46.74 cM
AA seq 190 aa
MASPVEASPGCASGLGPHRRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEA
KIQVWFQNRRAKRIKDRKPGALNSRLELPPNSCSLPDTPQLPWDPGTSSHPLHPTSSAQY
TSACPPQTSCLGPILGPGQSWSGAKVAAPWGTSGASGIHSSLEQIVPQTSLGNLSDLIYT
SAIVTNVDHF
NT seq 573 nt   +upstreamnt  +downstreamnt
atggccagtcctgtggaggcatctccaggctgtgccagtgggttgggtccccatcggagg
aagaggaccactttcagtgtcgggcagttggtggagctggagcgggtatttgcagctagg
ccctatcctgacatcagcacccgtgagcacctggctcaggtaactcacctgcctgaagcc
aagatccaggtgtggttccagaatcggcgagccaagagaatcaaggacagaaagccagga
gccctaaactccaggctggagcttcccccaaactcctgttctcttccagacactccccag
ctaccttgggaccctggaacatcaagccatcctctgcaccctaccagttcagctcagtat
acttcagcatgcccaccacagacctcctgcctaggccccattttgggtccagggcagagt
tggtcaggggctaaagtggcagccccatgggggacaagtggggcttcagggattcactct
tctttagagcaaattgttcctcagacttcactgggcaacctgtctgaccttatctatacc
tcagccatcgtcaccaatgtagaccacttctaa

DBGET integrated database retrieval system