KEGG   Mus musculus (mouse): 18293
Entry
18293             CDS       T01002                                 

Gene name
Ogdh, 2210403E04Rik, 2210412K19Rik, AA409584, d1401, mKIAA4192
Definition
(RefSeq) oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18293 (Ogdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     18293 (Ogdh)
SSDB
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT
Other DBs
NCBI-GeneID: 18293
NCBI-ProteinID: NP_001239216
MGI: 1098267
Ensembl: ENSMUSG00000020456
Vega: OTTMUSG00000000782
UniProt: Q60597
Position
11; 11 A1
AA seq 1023 aa
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEE
MYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNV
DKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLHES
DLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFET
PGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSAN
GVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINR
VTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDP
EAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKY
AELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPR
SMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMA
FGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSL
SEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLP
HGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFH
VLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKR
LLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEH
KNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFK
KFS
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgtttcatttaaggacttgtgctgctaagttaaggccattgacagcctcccagactgtt
aagacattttcacaaaacaaaccagcagcaattaggacgtttcaacagattcggtgctat
tctgcacctgtagctgctgaaccatttcttagtgggactagttcgaactatgtggaggaa
atgtactgtgcctggttggagaatcccaaaagtgtacataagtcatgggacatttttttc
cgaaacaccaatgctggagccccaccgggcactgcctaccagagccccctttccctgagt
cgaagctccctggctaccatggcccatgcacagtccctggtggaagcacaacctaacgtc
gacaaactcgtggaggaccacttggcggtgcagtctctcatcagggcatatcagatacga
gggcaccatgtagcacagctggaccccctggggattttggatgctgatctggactcctcc
gtgcccgctgacattatctcatccacagacaaacttgggttctatggcctacacgagtct
gaccttgacaaggtcttccacttacccaccaccactttcatcgggggacaggagccagca
cttcctcttcgggagatcatccgtcggctggagatggcctactgccagcacattggtgtg
gagttcatgttcattaatgatttggaacaatgccagtggatccgacagaagtttgagacc
cctggaatcatgcagttcaccaatgaggagaagcggaccttgctggccaggcttgtacga
tccaccaggtttgaggagttcctacagcgaaagtggtcctcggagaagcgttttggtctg
gaaggctgtgaggtgctgatccctgccctcaagacaatcattgatatgtcaagtgcaaat
ggagtggactatgtgatcatggggatgccacacagaggacggctgaacgtgcttgcaaat
gtcatcaggaaggagctggagcaaatattctgtcagtttgactcaaagctggaggcagct
gatgagggttctggggacatgaagtaccacctgggcatgtatcaccgcaggatcaaccgt
gtgaccgacagaaacatcactttgtccttggtggctaacccttcccatctagaggctgct
gaccctgtcgtgatgggaaagaccaaagctgaacagttctactgtggagacactgaaggg
aaaaaggtgatgtctatcctgctgcatggggatgctgcttttgctggccagggcatcgta
tatgagaccttccatctcagcgacttgccgtcctacacaacccatggcactgttcatgtg
gttgtcaacaaccagattggcttcaccacagaccctcggatggcccgctcctctccctac
cccactgatgtggcccgagtggtgaatgcccccattttccatgtcaactcagatgaccct
gaagctgtcatgtatgtatgcaaggtggcagctgagtggagaaacaccttccacaaggat
gttgtagttgatctggtgtgttatcgacgaaatggccacaatgagatggacgaacctatg
tttacacagccactcatgtacaagcagatccgcaagcagaagcctgtactgcagaagtat
gcagaattgctagtctcccagggtgtcgtcaatcagcctgagtacgaggaggaaatctcc
aagtatgataagatctgtgaggaagcatttaccagatccaaagatgagaagatcttgcac
atcaagcactggctggattccccctggcctggctttttcaccctggatggacagcccagg
agcatgacctgcccctccactggcctggaggaggatgtcttgttccacattggaaaggtg
gccagctctgtacctgtggagaactttactatccatggagggctgagccggatcttgaag
acccgcagagagcttgtgacgaaccggactgtggactgggccctggcagagtacatggca
tttggctcactgctgaaggaaggcatccatgtgcggctgagtggccaggatgtggagcgg
ggcaccttcagccatcgccaccatgtgctccatgatcagaatgttgacaaaagaacctgc
atccccatgaaccacctttggccaaatcaggccccttacactgtatgcaacagctcgctg
tctgagtacggtgtcctgggctttgagctgggctttgccatggctagccctaatgctctg
gttctctgggaggcccagtttggtgacttcaacaacatggcacagtgcatcattgaccag
ttcatctgcccaggacaggcaaagtgggtgcggcagaatggcattgtgctcctgctgcct
catggcatggaaggcatgggtcccgagcattcctctgcccgcccagagcggtttctgcag
atgtgcaatgatgacccagatgtcctgcctgacctgcaggaagaaaactttgacatcaat
cagctctatgactgcaactggattgttgtcaactgttccacccctggcaacttcttccat
gtgctgcgacgacagatcttgctgcccttccggaagccgttaatcgtcttcactcccaaa
tccctcctgcgccaccctgaggcaagaactagctttgacgagatgctgccaggaacgcac
ttccagcgtgtgatcccagaaaatggacctgcagctcaggacccacacaaagtcaagaga
cttctcttctgcactgggaaggtgtactatgacctcacccgagagcgcaaagccaggaac
atggaggaggaggtggctattacaaggattgagcagctatcaccattcccctttgacctc
ctgctgaaagaggcacagaagtatcccaatgctgagctggcctggtgccaggaagagcac
aagaaccaaggctactatgactatgtcaagccaagacttcgtaccaccattgaccgtgct
aagcctgtctggtatgctggccgagacccggcagctgctccagccactggcaacaagaaa
acacacctgacagagctgcagcgctttctggacacagcctttgacctggacgcattcaag
aaattctcttag

KEGG   Mus musculus (mouse): 239017
Entry
239017            CDS       T01002                                 

Gene name
Ogdhl
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    239017 (Ogdhl)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     239017 (Ogdhl)
SSDB
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT
Other DBs
NCBI-GeneID: 239017
NCBI-ProteinID: NP_001074599
MGI: 3616088
Ensembl: ENSMUSG00000021913
UniProt: B2RXT3 E9Q7L0
Position
14; 14 B
AA seq 1010 aa
MSQLRLLPFRLGPRATKLLATRAIPVFSGCRRSSGPPTTIPRSRSGVSSSYVEEMYFAWL
ENPQSVHKSWDSFFQRASKEASVGPAQPQLPAVLQESRTSVSSCTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFRLPTTTF
IGGPENTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSVEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDAQGRKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPTTGIPEEM
LTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKKRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPL
IVFTPKSLLRHPDAKSSFDQMVSGTSFQRLIPEDGPAAHSPEQVQRLIFCTGKVYYDLVK
ERSSQGLEQQVAITRLEQISPFPFDLIMREAEKYSGAELVWCQEEHKNMGYYDYISPRFM
TLLGHSRPIWYVGRDPAAAPATGNKNAHLVSLRRFLDTAFNLKAFEGKTF
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgagccagctgaggctgctgccattccggctggggccacgggccaccaagctcctggcc
acacgggctatcccggtgttcagtgggtgcaggaggtcttctggaccaccaacgaccatc
ccgaggagcagaagcggagtcagctccagttatgtggaagagatgtactttgcctggttg
gaaaacccacagagcgttcacaagtcctgggacagcttttttcagagagcaagtaaggag
gcctctgtgggtcctgctcagccgcagctcccagctgttctccaagaaagcaggacatca
gtgtcaagctgcaccaagaccagcaagctggtggaagaccacttggcagtccagtccctg
atccgggcctaccagatccgaggccaccatgtggcccagctggaccccctgggcatcctg
gatgcagacctagattcctttgtgccctctgacttgatcacaaccattgataaattggcc
ttctatgacctgcaggaggctgatctggataaggagttccggctgcccaccacgactttc
atcgggggcccagagaacacactctctcttcgagagatcatacgtcgcttggagagcacc
tactgccagcatattggcctggagttcatgtttattaatgacgtggaacagtgccagtgg
atcagacagaaatttgaaactcctggcgtgatgcagttttccgtcgaggagaagaggacc
ctgctggctagactggtgcgctccatgaggtttgaagacttcctggccaggaagtggtct
tcggagaagcggtttggcctggaaggctgcgaggtcatgattcctgctctcaagaccatt
atcgacaagtctagtgagatggggattgagaacgtcatcctggggatgccacacaggggc
aggctgaatgtgctggctaacgtgatccgcaaggacctggaacagatcttctgtcagttt
gatcccaagctggaagcagcagatgagggctctggtgatgtcaaataccatctgggcatg
taccacgagaggatcaaccgtgtcaccaacaggaacatcacattgtcactggtagccaac
ccttcccatctagaagctgtggaccccgtggtacagggcaagacgaaggcagagcagttc
taccgtggggatgcccagggtaggaaggtcatgtctatcctggtccatggggatgccgcc
ttcgctggccagggggtcgtctatgagaccttccatctcagtgacctgccttcttatacc
accaatggcacagtgcacgttgtggtcaacaaccagatcggcttcaccacagatccccga
atggctcgctcctccccttaccccactgatgtggcgcgggtggtcaatgcacccatcttc
catgtgaacgcagacgacccagaggctgtgatctatgtgtgcagtgtggcagctgagtgg
aggaacaccttcaacaaagatgttgttgtagacctggtctgttaccgccggcgtggtcac
aatgagatggacgagcccatgttcacgcagccactcatgtacaagcagatccacaagcag
gtacccgtgctgaagaagtatgcagacaagctcatcgccgagggcaccgtcactctgcag
gagtttgaggaggaaattgccaaatatgaccgtatctgtgaggaggcctacggcaggtcc
aaggataagaagatcctgcatataaagcactggctggactccccctggcctggcttcttc
aatgtggatggggagcccaagagcatgacatgccctacgacaggcatccctgaggagatg
ctgacccacattggcagtgtggccagctctgtgcccctggaggactttaagatccacaca
ggcctctctcgcatcctgcgtggccgtgcagacatgacaaagaagcgcacagtggactgg
gccctggcagagtacatggcctttggttcattgctgaaggagggcatccacgtgcgactc
agcggccaggatgtggagaggggcacattcagccaccggcaccatgttcttcatgaccag
gaagttgaccggaggacgtgtgtcccgatgaatcatctgtggcctgaccaggccccgtac
actgtgtgcaatagctccctctcagagtatggagttctaggctttgagctgggctatgcc
atggccagccccaacgccctggtcctctgggaagctcagtttggtgatttccacaacaca
gcccagtgtatcatcgaccagttcatcagcactggccaggccaagtgggtgcggcacaat
ggcatcgtgcttctgctgccccacggcatggagggcatgggtccagagcactcctcagca
aggccagagaggttcctgcagatgagcaatgacgactcggatgcctacccagtgttcact
gaggactttgaggtgagccagctctacgactgcaactggattgtggtgaactgctccacc
ccagccagctacttccacgtgctgcgccgacagatcctgctgcccttccgcaagcctctc
attgtcttcacacccaagtctctgctgaggcaccctgatgccaagtccagctttgaccag
atggtgtccggaactagcttccagcggctgattccggaagacggccccgcagcacattct
cctgagcaggtccagcggctcatcttctgcacgggaaaggtgtactatgacctggtaaag
gaacgcagcagccagggcctggagcaacaagtggccatcacacgcctggagcagatctct
ccgtttcctttcgacctgatcatgcgggaggcagagaagtactcgggagctgagctggtg
tggtgtcaggaggaacataagaacatgggctattacgactacatcagtccacgcttcatg
actctcctcggccactcccggcccatatggtatgtcggccgggacccagcagccgcacca
gccactgggaataagaacgctcacttggtgtcactgaggaggtttctggatactgccttc
aatctgaaggccttcgagggcaagacattttag

DBGET integrated database retrieval system