KEGG   Mus musculus (mouse): 18295
Entry
18295             CDS       T01002                                 

Gene name
Ogn, 3110079A16Rik, O, OG, OIF, S, SLRR3A, mim, mime, mimecan, mimican
Definition
(RefSeq) osteoglycin
  KO
K08126  osteoglycin (osteoinductive factor, mimecan)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    18295 (Ogn)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class III
    18295 (Ogn)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRR_5
Other DBs
NCBI-GeneID: 18295
NCBI-ProteinID: NP_032786
MGI: 109278
Ensembl: ENSMUSG00000021390
UniProt: Q62000 Q543C5
Position
13; 13 A5
AA seq 298 aa
METVHSTFLLLLFVPLTQQAPQSQLDSHVNYEYATGNSEETKFSQDYEDKYLDGKSIKEK
ETMIIPDEKSLQLQKDEVIPSLPTKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADMPNLRRLDFTGNLIEDIEDGTFSKLSLLEELTLAENQLL
RLPVLPPKLTLLNAKHNKIKSKGIKANTFKKLNKLSFLYLDHNDLESVPPNLPESLRVIH
LQFNSISSLTDDTFCKANDTRYIRERIEEIRLEGNPIALGKHPNSFICLKRLPIGSYF
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagactgtgcactctacatttctcctgctactcttcgtgcctctgacacagcaagca
ccacagtcgcagctggactcacatgttaactatgagtatgcaacaggcaattctgaagaa
accaaatttagccaggattatgaagataaatacctggatgggaaaagtattaaggaaaaa
gaaactatgataattcctgatgagaaaagtcttcagttacaaaaagatgaagttatacca
tcattaccaaccaagaaagaaaatgatgaaatgcccacatgcctgttgtgtgtctgctta
agtggctctgtctactgtgaagaagttgacattgatgctgtaccaccattgccaaaggaa
tcagcttatctttatgcacgattcaacaaaattaaaaagctgactgccaaggattttgca
gacatgccaaacctaagaagacttgattttacgggaaatttgatagaagacatagaagat
gggactttttcaaaactttctctgttagaagaacttacacttgctgaaaaccaactacta
agacttccagttcttcctccaaagcttactttacttaatgccaaacacaacaaaatcaag
agtaaaggaattaaagcaaacacattcaaaaaactgaataaactctcttttctctatttg
gaccataacgacctggaatctgtgcctcctaatttaccagaaagtctacgtgtaattcac
cttcagtttaacagcatatcttcacttacagatgatacattctgcaaggctaatgacact
cgttacattcgggagcgaattgaagagattcgcctggagggcaatccaattgctctggga
aagcatccaaacagttttatctgcttaaaaagattacccatagggtcatacttctaa

DBGET integrated database retrieval system