KEGG   Mus musculus (mouse): 18307Help
Entry
18307             CDS       T01002                                 

Gene name
Olfr10, GA_x6K02T2QP88-6117098-6116163, L45, MOR256-55
Definition
(RefSeq) olfactory receptor 10
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    18307 (Olfr10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18307 (Olfr10)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    18307 (Olfr10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 18307
NCBI-ProteinID: NP_996558
MGI: 107598
Ensembl: ENSMUSG00000100923
Vega: OTTMUSG00000005546
UniProt: Q60883
Position
11; 11 B1.2
AA seq 311 aa AA seqDB search
MGTFNISLGGGFILVGFSDWPALELIFFIHILIFYSITLFGNTAIIALSRTDLRLHTPMY
FFLSHLSFLDLCFTTSTVPQLLINLHGQDRTISYGGCVAQVFIFLALGSTESVLLVVMAF
DRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEM
PVFLKLVCEDTGGTEAKMFVARAVIVAVPTMLILGSYAQIARAVLKVKSVTARRKAAGTC
GSHLLVVSLFYGSAIYTYLQPKDSYSESKGKFVALFYTIITPMLNPLIYTLRNKDMKGAL
WKVLGRATVTG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccttcaatatcagtttgggaggaggcttcattttggtgggcttctcagactgg
cctgcacttgaactcatcttctttattcatattttgattttctactctataactctcttt
ggcaacacagccatcattgctctctcccgaacagaccttcgactacacacccccatgtac
ttctttctgtctcacctctccttcctggacctctgcttcaccaccagcaccgtgccccag
ctcctcatcaacctccatggacaagacaggaccatcagctatggaggctgtgtggcccag
gtcttcatatttcttgctctgggatccacagagagtgtgctcctggtggtgatggctttt
gaccgctatgctgctgtgtgtcgtccactgcactacacgaccatcatgcaccctgttctc
tgccaggcattggctattgcttcctgggtaggaggcttcttgaactctctgattcaaaca
ggcctcatgatggccatgccactctgtggacatcgactgaatcacttcttctgtgagatg
cctgtcttcctcaagttggtctgtgaagacacaggaggaacagaggccaagatgtttgtg
gccagagcagtgattgttgcagtgcctaccatgctcattctaggctcctatgcacagatt
gctagggcggtgctgaaggtcaagtcagtaactgcacgcagaaaggctgctgggacttgt
ggctcccacctcttggtggtttctctgttctatggctcagccatctacacatacttacaa
cccaaagacagctattctgagagcaaggggaagtttgtggcccttttttatactatcatc
accccaatgctcaaccctctgatctataccctgagaaacaaagatatgaagggggctctg
tggaaggtactaggaagagctacagtcacagggtag

DBGET integrated database retrieval system