KEGG   Mus musculus (mouse): 18343
Entry
18343             CDS       T01002                                 

Gene name
Olfr44, IB3, MOR171-5
Definition
(RefSeq) olfactory receptor 44
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    18343 (Olfr44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18343 (Olfr44)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    18343 (Olfr44)
SSDB
Motif
Pfam: 7tm_4 7tm_1 YrhK
Other DBs
NCBI-GeneID: 18343
NCBI-ProteinID: NP_667041
MGI: 1333829
Ensembl: ENSMUSG00000062649
Vega: OTTMUSG00000062348
UniProt: Q9EQB8 Q9Z1V5
Position
9; 9 A5.1
AA seq 314 aa
MNDMTSGNYCTVTEFFLAGLSEKPELQLPLFFLFIGIYMITVAGNLGMIILIGLSSHLHT
PMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNIISYPGCMTQLYFFLIFAIAECYILAA
MAYDRYVAICNPLLYNVTMSYQIYIFLISGVYIIGVICASAHTGFMVRIRFCKLDVINHY
FCDLLPLLKLACSNTYINEMLILFFGTLNIFVPILTIITSYIFIIASILRIRSTEGRSKA
FSTCSSHILAVAVFFGSLAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDV
AVALKKIIERKTFM
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaatgatatgacatcaggaaactattgcacagtgactgagttcttcttggcagggctc
tcagagaagccagaactccagctgcccctcttcttccttttcataggaatttatatgatc
actgtagcagggaatttgggcatgatcatactgattgggctcagttcccacctgcacaca
cccatgtactatttcctcagcagtctgtccttcattgacttctgtcagtccacagtcgtt
acccctaaaatgctagtgaactttgtgacagagaagaacatcatatcctaccctggatgc
atgactcagctctacttcttcctcatatttgcaattgcggagtgttacattttagctgca
atggcatatgaccgctatgttgctatctgtaacccattgctttacaatgtaaccatgtcc
tatcaaatttacattttcctaatttcaggagtgtatattattggtgtgatctgtgcatca
gctcacacaggcttcatggttagaattcgattctgcaaattagatgtgatcaaccactat
ttctgtgaccttcttcccctcttgaagcttgcatgctctaatacctatatcaatgaaatg
ttgattctattttttgggacactgaacatctttgtcccaatcctgaccattattacttcc
tacatcttcattattgccagcatcctccgcattcgctccactgaaggcaggtctaaagcc
ttcagtacttgcagttctcacatcttggctgttgctgtcttctttggatctctagcattc
atgtaccttcagccatcatcagtcagctccatggaccaagggaaagtgtcctctgtgttt
tataccattgttgttcccatgctgaaccccttgatctacagtctgaggaataaagatgtt
gctgttgccttgaaaaaaataattgaaagaaaaacatttatgtag

DBGET integrated database retrieval system