KEGG   Mus musculus (mouse): 18350Help
Entry
18350             CDS       T01002                                 

Gene name
Olfr50, ID3, MOR136-6
Definition
(RefSeq) olfactory receptor 50
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    18350 (Olfr50)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18350 (Olfr50)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    18350 (Olfr50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 18350
NCBI-ProteinID: NP_667157
MGI: 1333746
Ensembl: ENSMUSG00000111021
Vega: OTTMUSG00000012235
UniProt: Q8VGK5
Position
2; 2 B
AA seq 312 aa AA seqDB search
MMKSNQSTVSEFILLGLPIQPEDQAVYFALFLAMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVTAPKMLMNMLTHSQSISHAGCVSQIYFFLLFGCIDNFLLTSMAY
DRYVAICHPLHYTTIMSQSLCVLLVMVSWAFSSSNGLVHTLLFARLSLFRDNTVHHFFCD
LSALLKLSSSDTTINELVILTLAVVVITVPFICILVSYGHIGATILRTPSIKGICKALST
CGSHLCVVSLYYGAIIGLYFFPSSNNTNDKDVIVAVLYTVVTPMLNPFIYSLRNRDINGA
LRKTLSRRLCSH
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtctaatcagagcactgtgtctgagtttatcctcttagggctccccattcag
ccagaggatcaagctgtgtactttgccctgttcctggccatgtacctgacaactgtgctg
gggaacctgctcatcattcttctcattaggctggactctcacctccacacccccatgtac
ttcttcctcagtcacttggccttcacggacatctctttctcatctgtcacagctccaaag
atgctcatgaatatgctgacacatagccaatccatctcacatgctgggtgtgtttcccaa
atatattttttcttattgtttgggtgtattgacaacttccttctgacttccatggcctat
gacaggtatgtggccatctgccaccctctgcattataccactatcatgagtcaaagcctc
tgtgttctgctagtgatggtgtcctgggcattttcctcttctaatggccttgtgcatact
cttctctttgctcgtctctctctttttagagacaacactgtccaccattttttctgtgat
ctctctgctttgctgaagctgtccagctcagacactactatcaatgaactagtaatcctc
actttagcagtggtggtcatcactgtaccattcatatgcatcctggtttcttatggccac
ataggggccactatcctaagaactccatccatcaagggtatctgcaaagccttgtccaca
tgtggttctcatctctgtgtagtttctttgtattatggagccattattgggttatatttt
ttcccctcctccaataatactaatgataaagatgtcatagtagctgtgttgtacactgtg
gttacacccatgctgaatccctttatctatagtctgaggaatcgggatataaatggagca
ttgagaaagacactcagcaggagactgtgttcacactga

DBGET integrated database retrieval system