KEGG   Mus musculus (mouse): 18373
Entry
18373             CDS       T01002                                 

Gene name
Olfr9, MOR269, MOR269-3
Definition
(RefSeq) olfactory receptor 9
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    18373 (Olfr9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    18373 (Olfr9)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    18373 (Olfr9)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx IspA
Other DBs
NCBI-GeneID: 18373
NCBI-ProteinID: NP_667072
MGI: 107600
Ensembl: ENSMUSG00000069430
Vega: OTTMUSG00000056474
UniProt: Q60885 Q14A42
Position
10; 10 D3
AA seq 312 aa
MGDDNDTDITEFILLGFSGYGFLQGHLFWGVLCIYVVTLLGNSLIVLLTLADSALHSPMY
FFLRHFSVVEILYTTTIVPRMLADLRSSCPTIPLASCFTQLYFFALFGIAECCLLTAMAY
DRYAAICCPLHYTTLMSQGTYTGLVGASYLAGVISGTTHSIFIFTLPFRGAKTIHHFLCD
ILPVLRLATASTFWGEVGNLFVTITFIFVPFLLIVASYACILVTILGVATSQGRQKLFST
CSSHLFVVILFFGTATVAYMRPQADSFGNTDQILTLVYTVVTPMCNPFVYSLRNKEVTGA
MRRLMKRYLWGP
NT seq 939 nt   +upstreamnt  +downstreamnt
atgggggatgataatgatacagacataacagagtttattttactggggttctcgggttat
ggctttcttcagggccatctgttctggggtgtgctgtgtatctatgttgttaccttgctg
ggcaactctctgatcgtcctccttacgctggcggactctgcgctccactcccccatgtac
ttcttcctgcgtcatttctctgtggtggagatcctctacaccactaccattgtgcctcgg
atgttggctgacctccggtcttcctgccccaccatccctcttgccagctgcttcactcag
ttatatttctttgccctttttggcattgctgaatgctgcttgcttactgccatggcctat
gaccggtatgctgccatctgctgtccactgcattatactaccctgatgagccagggaacc
tatacaggcttggtgggggcctcttatcttgcaggtgtcatctcaggcactactcactcc
atcttcatcttcacgttgcctttccgtggggccaaaaccatccatcacttcctgtgtgat
atcctgcctgtgctgagactggctactgcaagcactttctggggtgaagtggggaacctc
tttgtcacaataacttttatcttcgtccccttcttattgattgtggcttcttatgcctgt
attcttgtcaccatccttggggtggcaacatcccagggtcgtcaaaagctcttttctaca
tgctcctcccacttgtttgtggtcatactcttttttgggactgcgactgttgcctatatg
aggccccaggctgattcatttgggaacacagaccagattcttactttggtctacacagtt
gtcacccccatgtgcaacccttttgtttatagtctgcgaaacaaggaggtcacaggggcc
atgaggcggctcatgaagagatacctttggggtccttga

DBGET integrated database retrieval system