KEGG   Mus musculus (mouse): 18377
Entry
18377             CDS       T01002                                 

Gene name
Omg
Definition
(RefSeq) oligodendrocyte myelin glycoprotein
  KO
K16666  oligodendrocyte myelin glycoprotein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    18377 (Omg)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_1 SERTA LRR_5
Other DBs
NCBI-GeneID: 18377
NCBI-ProteinID: NP_062282
MGI: 106586
Ensembl: ENSMUSG00000049612
Vega: OTTMUSG00000000194
UniProt: Q63912 Q8CAB4 G3XA53
Position
11 B5; 11 46.79 cM
AA seq 443 aa
MALMEYQILKMSSCLFILLFLTPGILCICPLQCTCTERHRHVDCSGRNLTTLPPGLQENI
IHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKS
DTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNN
SLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITY
LLKWVMETKAHVIGTPCSKQVSSLKEQSMYPTPPGFTSSLFTMSEMQTVDTINSLSMVTQ
PKVTKTPKQYRGKETTFGVTLSKDTTFSSTDRAVVAYPEDTPTEMTNSHEAAAATLTIHL
QDGMSSNASLTSATKSPPSPVTLSIARGMPNNFSEMPRQSTTLNLRREETTANGNTRPPS
AASAWKVNASLLLMLNAVVMLAG
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggctttgatggaatatcagatactgaaaatgtcttcctgcctgttcatccttctgttt
ctcacgcctggcatcttatgcatttgtcctctccagtgtacatgcacagagaggcacagg
catgtggactgttcaggcagaaacttgactacattaccacctggactgcaggagaacatt
atacatttaaacctgtcttataaccactttactgatctgcataaccagttaaccccatat
accaatctgagaaccctggatatttcaaacaacaggcttgaaagtctgcctgctcagtta
cctcggtctctctggaacatgtctgctgctaacaacaatattaaacttcttgacaaatct
gatactgcttatcagtggaaccttaaatacctggatgtttctaagaatatgctggaaaag
gttgttctcattaaaaataccctaagaagtctcgaggttcttaacctcagcagtaacaag
ctttggacagttccaaccaacatgccttccaaactgcatatcgtggacctgtctaataac
tcactgacacaaatccttccagggacattaataaacctgacaaatctcacacatctttac
ctgcacaacaataaattcacattcattccagaacagtcttttgaccaacttttgcagttg
caagagataactcttcataataacaggtggtcatgtgaccataaacaaaacattacttac
ttattgaagtgggtgatggaaacgaaagcccatgtgatagggactccttgttctaagcaa
gtatcctctctaaaggaacagagcatgtaccccacacctcctgggtttacctcaagctta
tttactatgagtgagatgcagacagtggacaccattaactctttgagtatggtaactcaa
cccaaagtgaccaaaacacccaaacaatatcgaggaaaggaaaccacatttggtgtcact
ctaagcaaagataccacttttagtagcactgatagggctgtggtggcctacccagaagac
acacccacagaaatgaccaattcccatgaagcagcagctgcaactctaactattcacctc
caggatggaatgagttcaaatgcaagcctcaccagtgcaacaaagtcacccccaagcccc
gtgaccctcagcatagctcgtggcatgccaaataacttctctgaaatgcctcgacaaagc
acaaccctcaacttacggagggaagaaaccactgcaaatggaaacactcggccaccttct
gcggctagtgcttggaaagtaaatgcctcgctccttttaatgctcaatgctgtggtcatg
ctggcaggctga

DBGET integrated database retrieval system